KEGG   Rattus norvegicus (rat): 100364335
Entry
100364335         CDS       T01003                                 

Definition
(RefSeq) cold shock domain-containing protein E1-like
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: CSD SUZ-C S1-like CusF_Ec DrrA_P4M
Other DBs
NCBI-GeneID: 100364335
NCBI-ProteinID: XP_003751901
RGD: 2321223
UniProt: P18395
Position
19q11
AA seq 798 aa
MSFDPNLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNL
QDLKVGDDVEFEVSSDRRTGKPIAIKLVKIKPEIHPEERMNGQVVCAVPHNLESKSPAAP
GQSPTGSVCYERNGEVFYLTYTSEDVEGNVQLETGDKINFVIDNNKHTGAVSARNIMLLK
KKQARYQGVVCAMKEAFGFIERGDVVKEIFFHYSEFKGDLETLQPGDDVEFTIKDRNGKE
VATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPSKNQNDPLPGRIKVDFVIPKELPFG
DKDTKSKVTLLEGDHVRFNISTDRRDKLERATNIEVLSNTFQFTNEAREMGVIAAMRDGF
GFIKCVDRDARMFFHFSEILDGNQLHIADEVEFTVVPDMLSAQRNHAIRIKKLPKGTVSF
HSHSDHRFLGTVEKEATFSNPKTTSPNKGKDKEAEDGIIAYDDCGVKLTIAFQAKDVEGS
TSPQIGDKVEFSISDKQRPGQQIATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDK
EIFFHYSEFSGDVDSLELGDMVEYSLSKGKGNKVSAEKVNKTHSVNGITEEANPTIYSGK
VIRPLRGVDPTQIEYQGMIEIVEEGDMKGEVYPFGIVGMANKGDCLQKGESVKFQLCVLG
QNAQTMAYNITPLRRATVECVKDQFGFINYEVGDSKKLFFHVKEVQDGIELQAGDEVEFS
VILNQRTGKCSACNVWRVCEGPKAVAAPRPDRLVNRLKNITLDDASAPRLMVLRQPRGPD
NSMGFGAERKIRQAGVID
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgagctttgatccaaaccttctccacaacaatggacacaacgggtaccccaatggtact
tctgcagcactccgtgaaactggggttattgaaaaactgctgacctcttatggatttatt
cagtgttcagaacggcaagctaggcttttcttccactgttcacagtataatggcaacctc
caggacttaaaagtaggagatgatgttgaatttgaagtatcatctgaccggaggactggg
aaacctattgctattaaattggtgaagataaaaccagaaatacatcctgaagaacgaatg
aatggacaagttgtgtgcgctgttcctcacaacttagagagtaaatctccagctgccccg
ggtcagagtccaacagggagtgtatgctacgaacgtaatggggaagtattttatctgact
tacacctctgaagatgtggaagggaacgttcagctggaaactggagacaaaattaacttt
gtaattgataacaataaacacactggtgctgtaagtgctcgtaacattatgctgttgaaa
aagaaacaagctcgctatcaaggagtagtttgtgccatgaaggaggcgtttggctttatt
gaaagaggtgatgttgtaaaagagatattctttcactatagtgaatttaaaggtgatcta
gaaaccctgcagcctggagatgacgtggaattcacaatcaaggacagaaatggtaaagaa
gttgcaacagatgtcagactattgcctcaaggaacagtcatttttgaagatatcagcatt
gaacattttgaaggaactgtaaccaaagttatcccaaaagtacccagtaaaaaccagaat
gacccattgccaggacgaatcaaagttgactttgtgattcctaaagaacttccctttgga
gacaaagacacaaaatccaaagtgaccctgctggaaggtgaccatgttaggtttaatatt
tcaacagaccgacgtgacaaattagaacgagcaaccaacatagaggttctatcaaataca
tttcagttcactaatgaagccagagagatgggtgtgattgctgccatgagagatggtttt
ggcttcatcaagtgtgtggaccgtgatgctcgtatgttcttccacttcagtgagattctc
gatgggaaccagctccacattgcagatgaagtggagtttactgtggtccctgatatgctc
tctgcccaaagaaatcatgctattaggattaaaaaacttcccaagggcacggtttcattc
cattcccattcagatcatcgttttctgggcaccgtagaaaaagaagccactttttctaat
cctaaaactacaagcccaaataaaggcaaagacaaggaggcagaagatggcattattgct
tatgatgactgtggggtgaaactgactattgcttttcaagccaaggatgtggaaggatct
acttctcctcaaataggagataaggttgaatttagtattagtgacaaacagaggcctgga
cagcagattgcaacttgtgtgagacttttaggtcgtaattctaattccaaaaggctcttg
ggttatgtggcaactctgaaagataattttggatttattgaaacagctaatcatgataag
gagatatttttccattatagtgagttctctggtgatgttgatagcctggaactgggagac
atggttgaatacagcttgtccaaaggcaaaggcaataaagtcagtgctgagaaagtaaac
aaaactcactcagtgaatggcatcactgaggaagcaaatcccaccatctactctggtaaa
gtcattcgtcctctgagaggcgttgatccaacacagattgaataccaaggaatgattgag
attgtggaggagggggatatgaaaggtgaagtgtatccttttggcatagttgggatggcc
aacaaaggggattgcctacagaaaggggagagtgttaagttccagttgtgtgtacttggc
caaaatgcacaaactatggcctacaacatcacaccccttcgtagggctactgtggagtgt
gtgaaagatcagtttggctttattaactatgaagtaggagatagcaagaagctctttttc
catgtgaaggaagttcaggatggcattgagctacaggcaggagatgaggtggaattctca
gtgatccttaatcagcgcactgggaaatgtagcgcctgtaatgtttggcgagtctgtgaa
ggccccaaagctgttgcagctcctcgacctgatcggttggttaatcgcttaaagaacatc
accctggatgatgccagtgctccacgtctaatggttcttcgtcagccaaggggaccagat
aactcaatgggatttggtgcagaaagaaagatccgtcaagctggtgtcattgactaa

DBGET integrated database retrieval system