KEGG   Rattus norvegicus (rat): 100364435Help
Entry
100364435         CDS       T01003                                 

Definition
(RefSeq) thymosin, beta 10-like
  KO
K13785  thymosin beta 10
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    100364435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymosin DUF4522 WH2
Motif
Other DBs
NCBI-GeneID: 100364435
NCBI-ProteinID: XP_002726998
RGD: 2321025
Ensembl: ENSRNOG00000036921
UniProt: P63312
Position
7q34
AA seq 44 aa AA seqDB search
MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaagccggacatgggggaaatcgccagcttcgataaggccaagctgaagaaa
accgagacgcaggagaagaacaccctgccgaccaaagagaccattgagcaggaaaagagg
agtgaaatctcctaa

DBGET integrated database retrieval system