KEGG   Rattus norvegicus (rat): 100365008
Entry
100365008         CDS       T01003                                 

Definition
(RefSeq) rCG54858-like
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: PSP94 VWC TILa
Other DBs
NCBI-GeneID: 100365008
NCBI-ProteinID: NP_001258251
RGD: 2324574
Ensembl: ENSRNOG00000043023
UniProt: D3Z9Y1
Position
5q22
AA seq 139 aa
MALRILWAGQAKGILGGWRVICLVVSLVLQHPGVNSKCYFQAQAPCQYEGKYFTLGESWL
RKDCFHCTCLHPVGVGCCDTSQHPIDFPAGCELQQEAGTCQFSLVQKADPRLPCKGGGPD
LEWGSANTPARGAPAPHSS
NT seq 420 nt   +upstreamnt  +downstreamnt
atggctctaaggatactctgggctggacaggccaaggggatcctgggaggctggagggtc
atctgcttggtggtgtccctggtcctgcagcacccaggagtcaacagcaagtgctacttc
caagctcaagctccctgccagtacgagggtaaatatttcactctgggtgaatcttggctc
cgcaaggactgcttccattgtacctgtctgcatcctgttggtgtgggctgctgtgacacg
tctcagcatcccattgacttccctgctgggtgtgaactgcaacaggaggccggaacctgt
cagttttccctggtgcaaaaagctgaccctcggctgccctgcaaagggggaggacctgac
ttagaatggggctcggctaacacccctgctcgtggggctcctgccccccactccagctaa

DBGET integrated database retrieval system