KEGG   Rattus norvegicus (rat): 100365921Help
Entry
100365921         CDS       T01003                                 

Gene name
Pigyl
Definition
(RefSeq) rCG31672-like
  KO
K11001  phosphatidylinositol N-acetylglucosaminyltransferase subunit Y
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
rno01100  Metabolic pathways
Module
rno_M00065  GPI-anchor biosynthesis, core oligosaccharide
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    100365921 (Pigyl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIG-Y
Motif
Other DBs
NCBI-GeneID: 100365921
NCBI-ProteinID: NP_001258904
RGD: 2318067
Ensembl: ENSRNOG00000052134
UniProt: M0R7L2
Position
8q13
AA seq 71 aa AA seqDB search
MILSLPTLTVLIPLISLAGLFYSASVEENFPEGCTSASSLCFYSLLLPVTVPVYVFFHLW
TWMGLKLFRHN
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgtctctgcccaccctgactgtcctcatcccgctcatctccctggcgggcctg
ttctactccgcctctgtggaagaaaacttcccagagggctgtaccagcgccagcagcctg
tgcttctacagtttgcttctgccggtcaccgtaccggtgtacgtgttcttccacctgtgg
acttggatgggcctgaagctcttcagacataactag

DBGET integrated database retrieval system