KEGG   Rattus norvegicus (rat): 100365935Help
Entry
100365935         CDS       T01003                                 

Gene name
Cep85l
Definition
(RefSeq) centrosomal protein 85-like
  KO
K16766  centrosomal protein CEP85
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100365935 (Cep85l)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100365935 (Cep85l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16
Motif
Other DBs
NCBI-GeneID: 100365935
NCBI-ProteinID: NP_001171300
RGD: 2319745
Ensembl: ENSRNOG00000000414
UniProt: F7EXF4
Position
20q11
AA seq 805 aa AA seqDB search
MWGRFLAPEAGGRDSPGGARSFPAGSDYSSAWLPGNESLWQATAVPSNPRNNHIRRHSIT
SDSGDTGIGTSCSDSVEDHSTSSGTPSLKPSGSLLTPPTAHVMPCNSSASVSKHRGDLPS
DGSKWSTNLMQTLGEHGTGERDSSLHMKDFRPLRKWSSLSKLTALENRNQSAIAYTQELR
NVLEKTGKGKAFTSHLRTFGPSCFHDTMEMLKLEDKQVNTKRPSTPHCKDKFESCNKEDV
RVSSSALRRQTLDMTYSALPESKPIVTGSEACESPKYLMLGQQAVGGVPIQPSVRTQMWL
TEQLRTNPLEGRTTEDSYSLAPWQQPQTEEFQQGSETPMQVLTGSSRQTYSPPGFQDFSK
WESVLKIKEGLLRQKEIVIDRQKQQINHLHERIRDNELRAQHAMLGHYVNCEDSYMSSLQ
PQYESSSGQTPFTEQPLSHPHQEELEQKLASTEKEVLQLNEFLKQRISQFSEEKKKLEEK
LKTRDRYISSLKKKCQKESEQNKEKQRRIETLEKYLADLPTLDDVQSQSLQLQVLEEKNK
NLQETLIDTEKKLEEIKKQCQDKEVQLLCQKKKEKELVTSVQSLQQKVEKCLEDGIRLPM
LDAKQLQSENDSLREQNATASKIIESQQDEINRMILEIQSMQGKLCKEKLSARSTVEELG
RKEESLQRLTEALLENQRHMGETYSLLDQGHEAEQSRPQTVPKWPLFDLTVIDQLFKEMS
YCLFDLKALCSILNQRAQGKEPNLSLLLGIRSMNCSAEETENDHSPETLTKKLSDVCQLR
RDIDELRTTISDRYAQDMGDNCVTQ
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgtggggccgtttcctggccccggaggctggcggccgggacagccccggcggggcccgc
agcttccctgcgggctcggactattcatcagcatggttacctggtaatgaatcattatgg
caggccacagctgttccatctaacccccgaaataaccatatccggagacacagcataacg
tctgacagtggagacactggcattggcacttcctgttctgacagcgtggaagaccactca
acttccagtggcacgccatctttgaagcctagtggatcgctgcttacccctcccactgcc
catgtgatgccatgtaactccagtgcttcagtttccaaacacaggggagatctaccgtca
gacggctctaaatggagtactaatctcatgcagacactgggagagcacggcacaggggag
cgggactcctccctacacatgaaggacttcaggcccctgaggaagtggtcatctctgtcc
aagcttactgccctggagaaccgcaaccagagtgccattgcatacacgcaagagttgagg
aatgtcttggagaagacagggaagggcaaggctttcacgtcccacttacggacctttggg
cctagctgcttccatgacactatggagatgcttaaactggaagacaagcaagtgaacacg
aaacggccatcaactccgcactgcaaggataaatttgagagctgcaacaaagaggatgtc
agagtctcttcctctgctctcaggagacagactttagacatgacatacagtgccttacct
gagagcaagcccattgtgacaggctcagaggcttgtgagtctccaaagtatttaatgctg
ggccagcaggcagtaggtggagttcccattcaaccttctgtgaggactcagatgtggctt
acagagcagttacggacaaacccattggaaggcagaaccacagaggattcttacagttta
gctccttggcaacagccacaaactgaagagtttcagcaaggaagtgagacaccaatgcag
gttttgactggatcatctcgtcagacttattcacctcctggtttccaggatttcagtaaa
tgggaatcagtgctgaaaataaaagaaggacttctgaggcagaaggaaattgtaattgat
aggcagaagcaacaaattaaccacctacatgaaaggataagggataatgaactacgggcg
cagcatgctatgctaggacattatgtcaattgtgaagactcctacatgagtagtttacag
cctcaatacgagagcagttcaggccagactccatttacagagcagccactgtcccatccc
caccaggaagaacttgagcaaaagctagcatctaccgagaaagaagttttgcagctcaat
gagtttctcaaacaaagaataagccaattcagtgaagagaagaagaaattagaggaaaag
ctgaaaaccagagacagatacatcagcagcctgaaaaagaaatgccagaaggagtctgag
caaaacaaagagaagcagagacggatcgagaccttggaaaagtacctggccgatcttcca
actctagatgacgtccagagtcagagtctgcagcttcaagttcttgaagaaaaaaacaag
aatttgcaagaaactttgatagacacagagaagaagcttgaggagatcaagaagcaatgt
caagacaaagaagtgcagctgctgtgccagaagaagaaggagaaggagctggtaacgtcc
gttcagagcttacaacaaaaagtagaaaaatgccttgaagatggaatccgccttcccatg
ttagatgccaaacagcttcagagtgaaaacgatagtctcagagagcagaatgcgacagcc
agtaagataatagagagccagcaggatgaaattaacagaatgattttagaaattcagtct
atgcaaggaaaactttgtaaagagaaattgagtgcacggagcactgtggaagagctagga
aggaaagaagagagcctccagaggttgacagaagcactgcttgaaaaccaaagacacatg
ggagagacatactctttactggatcagggccatgaagcagagcagtctaggccacagacc
gttcctaagtggcctctctttgatttgactgtgattgatcagctgttcaaggaaatgtcc
tattgtttgtttgacttgaaagcattgtgtagtattcttaatcaacgcgctcagggcaag
gagccgaacctctccttgttactgggaatccgatcaatgaactgttcagctgaagagact
gaaaatgaccacagcccagaaacgctcactaaaaagctctcggatgtgtgccagttacgg
agggacattgatgaattgaggactacaatatcagaccgctatgctcaggacatgggagac
aactgtgttacccagtga

DBGET integrated database retrieval system