KEGG   Rattus norvegicus (rat): 100909548Help
Entry
100909548         CDS       T01003                                 

Definition
(RefSeq) cation-dependent mannose-6-phosphate receptor-like
  KO
K10089  cation-dependent mannose-6-phosphate receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04145  Phagosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100909548
   04142 Lysosome
    100909548
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100909548
   04091 Lectins [BR:rno04091]
    100909548
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100909548
Lectins [BR:rno04091]
 P-type lectins
  100909548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Man-6-P_recep ATG27 CIMR CymA
Motif
Other DBs
NCBI-GeneID: 100909548
NCBI-ProteinID: XP_003752148
RGD: 6502964
Ensembl: ENSRNOG00000014992
UniProt: Q6AY20
Position
Xq31
AA seq 278 aa AA seqDB search
MFPLSGCWRTELLLLLLLAVAVRESWQIEEKSCDLVGEKDKESKNEVALLERLRPLFNKS
FESTVGQGSDTYSYIFRVCREAGNHSSGAGLVQINKSNEKETVVGRINETHIFNGSNWIM
LIYKGGDEYDNHCGKEQRRAVVMISCNRHTLAGNFNPVSEERGKIQDCFYLFEMDSSLAC
SPEVSHLSVGSILLVIFASLVAVYIIGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADG
CDFVCRSKPRSVPAAYRGVGDDQLGEESEERDDHLLPM
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgttccctctctctggctgttggaggactgaactgttactgttgctactcctggctgtg
gctgtgagagaatcctggcagatagaagaaaaatcgtgtgacctggtaggagaaaaggat
aaggagtcaaagaatgaggtggctctcctggagaggttacggccactgtttaacaaaagt
tttgagagtactgtgggccagggctcagacacttacagctatatattcagagtatgccgg
gaagctggcaaccactcctctggcgcaggcctggtccagatcaacaaaagtaatgagaag
gaaacggtggttgggagaatcaacgagactcacatcttcaatggaagtaactggatcatg
ttgatatataaagggggtgacgaatatgacaaccactgtggcaaagaacagcgccgtgca
gtggtgatgatctcctgcaatcgacacacactcgcgggtaattttaacccagtgtctgag
gaacgcggcaaaatccaggattgcttctacctctttgagatggatagcagcctagcctgt
tcaccagaggtctcacacctcagtgtgggctccatcctccttgtcatatttgcatcattg
gttgctgtttacatcattgggggtttcttataccagcgactggtagtgggggccaagggg
atggagcagtttcctcatctggccttctggcaggatcttggcaacctagtagctgatggt
tgtgactttgtgtgccgttccaaaccccgcagtgtgcctgcggcctatcgtggcgtcggg
gatgaccagctgggggaagagtcagaagaaagggatgaccatttgctaccaatgtga

DBGET integrated database retrieval system