KEGG   Rattus norvegicus (rat): 100909648
Entry
100909648         CDS       T01003                                 

Definition
(RefSeq) vasopressin V1b receptor-like
  KO
K04227  arginine vasopressin receptor 1B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100909648
   04072 Phospholipase D signaling pathway
    100909648
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100909648
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100909648
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    100909648
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Vasopressin
    100909648
SSDB
Motif
Pfam: 7tm_1 DUF1856 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4 Srg
Other DBs
NCBI-GeneID: 100909648
NCBI-ProteinID: NP_001276729
RGD: 6502812
Ensembl: ENSRNOG00000049261
UniProt: G3V6U8
Position
13q13
AA seq 421 aa
MNSEPSWTATPSPGGTLPVPNATTPWLGRDEELAKVEIGILATVLVLATGGNLAVLLTLG
RHGHKRSRMHLFVLHLALTDLGVALFQVLPQLLWDITYRFQGSDLLCRAVKYLQVLSMFA
STYMLLAMTLDRYLAVCHPLRSLRQPSQSTYPLIAAPWLLAAILSLPQVFIFSLREVIQG
SGVLDCWADFYFSWGPRAYITWTTMAIFVLPVAVLTACYGLICHEIYKNLKVKTQAGREE
RRGWRTWDKSSSSAATRGLPSRVSSISTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMW
SVWDENAPNEDSTNVAFTISMLLGNLSSCCNPWIYMGFNSRLLPRSLSHHACCTGSKPQV
HRQLSTSSLTSRRTTLLTHACGSPTLRLSLNLSLRAKPRPAGSLKDLEQVDGEATMETSI
F
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgaattctgagccttcttggactgccaccccctcccctgggggcaccctgcctgtcccc
aatgctaccacaccgtggctaggtagggatgaagagctagccaaggtggagatcggtatc
ctagctactgtcctggttctggccacaggaggcaacctggctgtacttctgactctgggc
cgccatggccacaagcgctcccgcatgcatctgttcgtgctgcacttggccctgaccgac
ctgggcgtggcgcttttccaggtactgcctcagctgctctgggacatcacctaccgcttc
cagggctctgacctcctctgccgggctgtcaagtatctacaggtgctcagcatgtttgct
tccacttacatgctgctggccatgacactggaccggtacctggctgtctgtcaccctctt
cgaagcctccggcagcccagccagtctacctaccctctcattgctgctccctggttgctg
gctgccatcctcagcctccctcaagttttcattttttcattgcgagaggtgatccagggc
tcaggggtgctggactgctgggcagatttctacttttcctggggcccgcgggcctacatc
acctggaccaccatggctatctttgtgctgccggtggcggtgctcacagcttgctacggc
ctcatctgccacgagatctacaagaacctgaaagtcaagacccaggctggcagggaggag
aggaggggctggcggacttgggataagtcctcatcttctgcagccacgagggggctacct
tcccgggtcagcagcatcagtaccatctccagggcaaagatccgaaccgtgaagatgacc
tttgtcatcgtgctggcctacattgcttgctgggcacctttcttcagtgtccagatgtgg
tctgtgtgggatgagaatgcccccaatgaagattctaccaatgtggctttcaccatctcc
atgcttctgggcaacctcagcagctgctgcaacccctggatctacatgggcttcaacagt
cgcctgttgccacgttccttgagccaccatgcctgctgcacgggctctaagccccaagtg
cacaggcaactctccaccagcagcctcactagccgtcgcactacgctgctgacccatgcc
tgtggttcccctactctccgactcagccttaacctcagcctccgtgcaaagcccagacct
gcaggctcactgaaggatttagagcaggtggacggggaagccactatggagaccagcatc
ttttag

DBGET integrated database retrieval system