KEGG   Rattus norvegicus (rat): 100909661Help
Entry
100909661         CDS       T01003                                 

Definition
(RefSeq) putative keratin-associated protein 10-like ENSP00000375147 homolog
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Keratin_B2_2 Keratin_B2 PMG
Motif
Other DBs
NCBI-GeneID: 100909661
NCBI-ProteinID: XP_003750981
RGD: 6502238
Ensembl: ENSRNOG00000053360
Vega: OTTRNOG00000000237
UniProt: A0A0G2KA19
Position
10q31
AA seq 493 aa AA seqDB search
MAGCCCSRKCPSLPAISLCSTEVSCGGPICLPSSCRSQTWQLVTCEDSCGSSGCGSQCCQ
PSCSVSSCCQPVCCEATICEPSCSVSSCAQPVCCEATICEPSCSVSSCAQPVCCEATICE
PSCSMNTCAQPVCCEATMCQPVCCETTSCQPVLCLPTSCQPVICKPSCCQPVICEPSCCS
AVCTVPASCQPMICEPVICEPACCQPVCPTPSCCPSVCSATSSCQPVDCESSPCEPPCSE
ASACQPTACMALVCESVCLRPVCCVQGPCEPPCGSSSCQDSSCCVSSICQPVCPEPSPCL
PSVCVPSPCQPSCYIVKRCRSVCCEPVSCPSPSCQPACCRPGSSASAICQPACPPRTFYI
PSSCKPSCSPVSCRPICRPICSGPITFRQPYVTSITYRPACYRSCYSILRRPTCLASYSY
RPVCSRQPCTDSDSDKTDCKKPTSSQPDCADSTPGKTEVPDETPCQPSEIKPASPITREA
AGPQTAASKPADR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggctggctgctgttgctctaggaaatgcccctccctgcccgccatctccctctgctct
accgaggtgagctgcggaggacccatctgtctacccagctcctgccggagtcagacatgg
cagctggtgacttgtgaggacagctgtgggtcatctggctgtggctcccaatgctgtcag
ccctcatgttccgtgagcagttgctgccagccagtgtgctgcgaggccaccatttgcgag
ccctcctgttctgtgagcagctgtgcccaacctgtgtgttgcgaggccaccatttgcgag
ccctcctgttctgtgagcagctgtgcccaacctgtgtgttgtgaggccaccatttgtgag
ccttcctgttccatgaacacctgtgcccaacctgtgtgctgcgaggccaccatgtgtcag
cctgtgtgttgtgagactacatcctgtcagcctgtcctctgcttgcctacctcctgccag
ccagtgatctgtaaacccagctgctgccagccagtcatctgcgagcccagctgttgctca
gctgtctgcactgtgcctgcttcctgccaaccaatgatctgtgagcctgtgatttgtgag
cctgcttgctgccagccagtatgcccgacacctagctgctgtccatctgtctgctctgca
accagtagctgccagccagtcgactgtgagtccagtccctgtgagccaccttgctcagag
gccagtgcttgtcaaccaactgcctgtatggctctggtgtgtgagtctgtttgtctccgt
cctgtctgctgtgtccagggcccttgtgagccaccatgtggttctagcagctgccaagac
tcctcatgttgtgtctccagtatttgccaacctgtctgccctgagcccagcccttgctta
ccatcggtgtgtgtgcccagtccatgccaaccttcctgctacatagtcaaacgatgccgt
tctgtctgctgtgagcctgtttcctgcccatctccctcctgccaacctgcttgctgccgt
cccgggtcttctgcatctgctatctgccaaccagcttgcccacctcggactttctacata
cccagttcctgcaagccatcttgtagtccagtttcttgccgccctatctgccgccccatc
tgttctggacccatcaccttcaggcaaccatatgtgacatccatcacctaccgccctgcc
tgctaccgctcctgctactccatactacgccgtcccacctgcctagcttcttactcctac
cgccctgtctgctcccgccagccttgcaccgattctgacagcgataagactgattgcaaa
aagccaacttccagtcaacccgactgtgctgactcaacacctggcaagacagaggttcca
gatgagactccctgccagccttctgagatcaaacccgccagccccatcacccgtgaggca
gcaggcccccagactgctgccagcaagcctgctgaccgctaa

DBGET integrated database retrieval system