KEGG   Rattus norvegicus (rat): 100909732Help
Entry
100909732         CDS       T01003                                 

Definition
(RefSeq) protein FAM122B-like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 100909732
NCBI-ProteinID: XP_003752205
RGD: 6501955
Ensembl: ENSRNOG00000050146
UniProt: D3ZN42
Position
Xq37
AA seq 254 aa AA seqDB search
MAQEKMELDFEADTSEGGTLRRSNSAPLIHVLSDLSQVFEPYPLRTGRNSATVMSHHSLE
EGLDLMNRETANEREPQGGMQISHSWDESLSLSDSDFDKPEKLYSPKRIDFTPVSPAPSP
TRGFGKCTSPSLQMFVGSSEVPPSSVPNPRHFSRRSQSPVKCIRPSVLGPLKRKGEMEIE
SQPKRPFQGATNMLSTDATQLSDFSSCSDILDGSSVSSGLSSDSLATGSAPAESPVACSN
PCSSFILMDDLSPK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggagaaaatggagctggattttgaggctgacacatctgaggggggcaccctg
agacggtccaacagtgctcccctgatccatgtgctcagtgacctttcccaggtttttgag
ccatatccacttagaactgggaggaacagtgcgacagttatgagccatcatagcttggaa
gaaggcctggatttgatgaacagagaaactgcaaatgaaagagaaccacaaggaggaatg
cagataagccactcatgggacgaaagcttaagcctgagcgatagtgattttgacaagcca
gagaaattatattctccaaagagaattgacttcactccagtttctccagcgccttcccca
accagaggatttggaaagtgcacatcgccatccttgcaaatgtttgtgggcagcagtgag
gtgccaccaagttctgttcctaatccaagacatttttcaaggaggagtcagagcccagtc
aagtgcattaggcccagcgttcttggtcctcttaagagaaaaggggaaatggagatagaa
agccagcctaagagaccgttccaaggagcaaccaacatgctgtctacagatgctacacaa
ttgtctgatttcagttcatgttcagatattttggatggcagtagtgtcagcagtggcttg
tcctcagactcactggctacaggcagcgctcccgcagagtctccagtagcatgctccaat
ccatgctcttcgttcatcttgatggatgatctctcacccaagtga

DBGET integrated database retrieval system