KEGG   Rattus norvegicus (rat): 100909761Help
Entry
100909761         CDS       T01003                                 

Definition
(RefSeq) myotilin-like
  KO
K19875  myotilin
Organism
rno  Rattus norvegicus (rat)
Brite
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    100909761
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100909761
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set BiPBP_C C2-set_2 Ig_6 Transposase_22
Motif
Other DBs
NCBI-GeneID: 100909761
NCBI-ProteinID: XP_006255052
RGD: 6502123
UniProt: M0RCF7
Position
18q12.3
AA seq 497 aa AA seqDB search
MFNYERPKHFIQSQNPCGSGLQPPGPEVSSFPNQTKQSSIVIQPRQCTEQRFSASSTVSS
HITVSSSAYPASQQLAGPNPGQKVTATYNQSPASFLSSILPSQPDYSNSKIPSTVDSNYQ
QSSVHQPVNAVSSQAAGAKPTPRTPDHEIQGSKEALIQDLERKLKCKDTLLHNGNQRLTY
EEKMARRLLGPQNAAAVFQAQNSDVQDSSQQHNPEHARLQVPTSQVRSRSSSRADANDQD
AIQEKFYPPRFIQVPENMSIEEGRFCRMDFKVSGLPAPDVSWYLNGRLVQSDELHKMIVS
EKGFHSLIFEVVRASDAGPYACVARNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKVF
EGESVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYHDNAGRVTLLIKDVNKKDAGWY
TVSAVNEAGVTTCNTRLDVTARPNQTPPAPKQLRVRPTFSKYLALNGKGLDVKQAFNPEG
EFQRLAAQSGLYESEEL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtttaactacgaacgtccaaaacacttcatccagtcccaaaatccatgtggctccggg
ctgcagcctccaggacctgaagtctccagcttccctaaccagaccaaacagtcttccatc
gtcatccagcctcgccaatgcaccgagcagagattttctgcttcctccacagtgagctct
cacatcaccgtgtcttcctctgcttatcctgcttcccagcagctggctggccccaacccc
ggtcagaaggttactgctacctataaccagtccccagccagcttcctcagttctatatta
ccgtctcagcctgattacagtaacagtaaaatcccatccactgtggactccaactatcaa
caatcctcagttcaccaacctgtaaatgccgtgtcatcccaagctgcaggtgctaagccc
actccaaggactcctgaccacgaaatccaaggatcaaaagaagcattgattcaagatttg
gaaagaaagctgaaatgcaaagacacccttcttcataatggaaaccaaagactgacctat
gaggagaagatggctcgcaggttgttaggaccgcagaatgctgctgctgtgtttcaagct
caaaacagtgacgtccaagattcgtcacagcagcataacccagaacatgcacggctgcaa
gttcccacatcacaagtaagaagtagatcgtcctccagagcagacgcaaatgaccaggat
gccatccaggagaagttttacccaccacgcttcattcaagtgccagaaaatatgtccatc
gaagaaggaagattctgcagaatggactttaaagtgagtggactgccagcccctgatgtg
tcatggtatctaaacgggagactggtgcaatcagatgagttgcacaaaatgatagtgtca
gagaagggtttccactccctcatctttgaagtggtcagagcatcagatgcagggccatat
gcatgtgtagccagaaacagagctggagaagccaccttcacagtgcagctggatgttctg
gcaaaagagcacaaaagagcaccgatgtttatctacaaaccacagagcaaaaaggttttt
gagggagaatcagtgaagttagagtgccagatctcagctatccctccaccaaagcttttc
tggaaaagaaacaacgaaatggttcagttcaacactgaccggataagcttatatcatgat
aatgctggaagagtaactttactgataaaagatgtaaacaagaaggatgctgggtggtat
acagtgtcagcagtcaatgaagctggcgtgaccacgtgtaacacaagattagatgtcaca
gcccgtccaaaccaaactcccccagctcctaagcaactgcgtgttcgaccaactttcagc
aaatatttagccctaaatgggaaaggtttggatgtgaaacaagctttcaaccctgaagga
gagtttcagcgtctggcagctcaatccggactctatgaaagtgaagaactttaa

DBGET integrated database retrieval system