KEGG   Rattus norvegicus (rat): 100909833
Entry
100909833         CDS       T01003                                 

Definition
(RefSeq) N-alpha-acetyltransferase 11-like
  KO
K20791  N-alpha-acetyltransferase 10/11 [EC:2.3.1.255]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100909833
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.255  N-terminal amino-acid Nalpha-acetyltransferase NatA
     100909833
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    100909833
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47 Acetyltransf_9 Acetyltransf_13 Acetyltransf_3 Acetyltransf_15 COP-gamma_platf
Other DBs
NCBI-GeneID: 100909833
NCBI-ProteinID: XP_003752314
RGD: 6501755
Ensembl: ENSRNOG00000061294
UniProt: M0R635
Position
Un
AA seq 220 aa
MNIRRARPDDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDEDGKIVGYVLAKM
EEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFSAKYVSLHVRKSNRAALH
LYSNTLNFQVSEVEPKYYADGEDAYAMKRDLSQMADELRRQLVLKKGRYVVLGSKENQGS
TLPGSEEASQQENLAGGDSGSDGKDSTDVQDSLQTLGSAS
NT seq 663 nt   +upstreamnt  +downstreamnt
atgaacatccgccgggctcggccagatgacctgatgaacatgcagcactgcaacctgctg
tgcctgcccgagaactaccagatgaagtactacttctatcatggcctctcttggccccag
ctctcctacattgctgaggacgaggatgggaagattgtgggctatgtcctggccaagatg
gaggaggaccccgatgatgtccctcacggacacatcacctcgctggctgtgaaacgctcc
caccggcgcctcggcctggcccagaagctcatggaccaggcttccagggccatgattgag
aacttcagcgctaagtatgtatccctgcatgtcaggaagagcaaccgggcggctctgcac
ctgtattccaacaccctgaacttccaggttagcgaggtggagcccaagtactatgcagat
ggggaagacgcgtatgctatgaagcgagatctctcgcagatggccgatgagctgagacgg
cagctggtgctgaagaaaggcagatatgtggttctgggctccaaggagaatcagggtagc
acacttcctggttctgaagaggccagtcagcaggagaacctggccggaggtgacagtggt
agtgatggcaaagacagcactgatgtccaagacagcttgcagaccctagggtccgcctcc
tag

DBGET integrated database retrieval system