KEGG   Rattus norvegicus (rat): 100909836Help
Entry
100909836         CDS       T01003                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial-like
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00970  Aminoacyl-tRNA biosynthesis
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100909836
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    100909836
Enzymes [BR:rno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     100909836
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     100909836
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100909836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 100909836
NCBI-ProteinID: XP_003751247
RGD: 6501760
Position
12q16
AA seq 167 aa AA seqDB search
MWAQAARVQFRAPLDRGRSFASKVGPRGKVQAADPKTQAPRLVPEGTDRVSAAVVEHLER
LALVNFSSREAVDRLEKAVAFADQLHAVDTDGVEPLESVLEDRCLYLRSDKVAEGGCAEE
LLQNSNHVVEEYFVAPPGMLPRVLQTFLLETYYLNAKGQSAQWWHCT
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcacaggcggcgagggtgcaatttcgggctcctctggaccggggccgaagtttt
gcttccaaagtgggtccacgcggaaaggtccaggcggcggacccgaagacccaggctcca
cgcctagtcccggagggcaccgatcgcgtgtccgccgcggtagtcgagcatctggagcgg
ctggcactggtgaacttcagcagccgcgaggcggtggaccggctagagaaagccgtggcc
tttgccgaccagctgcacgccgtggacaccgacggggtggagcccctggagtcggttctg
gaggacagatgtctctacctgagatctgacaaggtagccgaaggcggctgtgcagaagaa
ctactacagaactcaaatcacgttgtggaggagtactttgtggcccccccaggtatgtta
cccagagtgcttcagacattcttgctggagacatactatctgaacgcaaaaggacaaagt
gcacagtggtggcattgtacatga

DBGET integrated database retrieval system