KEGG   Rattus norvegicus (rat): 100909840
Entry
100909840         CDS       T01003                                 

Definition
(RefSeq) profilin-2-like
  KO
K05759  profilin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05014  Amyotrophic lateral sclerosis
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100909840
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100909840
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100909840
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100909840
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    100909840
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    100909840
   04147 Exosome [BR:rno04147]
    100909840
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    100909840
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100909840
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   100909840
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 100909840
NCBI-ProteinID: XP_003749330
RGD: 6501768
Ensembl: ENSRNOG00000017427
UniProt: Q9EPC6
Structure
PDB: 
2VK3

Position
2q26
AA seq 140 aa
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPAEIDVIIGKDREGFF
TNGLTLGGKKCSVIRDSLYVDSDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSGF
NT seq 423 nt   +upstreamnt  +downstreamnt
atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc
cagagcatcacgccagcagaaatagatgtgattataggaaaagaccgggaaggtttcttt
accaatggtttgactcttggaggaaagaagtgctctgtgatcagagatagcctatacgtt
gactcggactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac
gttgctgttggcagagctgggagagtcttggtctttgtaatgggaaaagaaggggtccat
ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc
tag

DBGET integrated database retrieval system