KEGG   Rattus norvegicus (rat): 100909857
Entry
100909857         CDS       T01003                                 

Definition
(RefSeq) cytidine deaminase-like
  KO
K01489  cytidine deaminase [EC:3.5.4.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00240  Pyrimidine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    100909857
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100909857
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     100909857
SSDB
Motif
Pfam: dCMP_cyt_deam_1 dCMP_cyt_deam_2
Other DBs
NCBI-GeneID: 100909857
NCBI-ProteinID: XP_003750114
RGD: 6501229
Ensembl: ENSRNOG00000049700
UniProt: D4AC20
Position
5q36
AA seq 146 aa
MAQERPSCAVEPEHVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNVENACY
PLGVCAERTAIQKAISEGYKDFRAIAIASDLQEEFISPCGACRQVMREFGTNWAVYMTKP
DGTFVVRTVQELLPASFGPEDLQKIH
NT seq 441 nt   +upstreamnt  +downstreamnt
atggcccaggaacgcccctcctgtgccgtggagcctgagcacgtccagcggctgctgctg
tcctctcgtgaagccaagaagtcagcctactgcccctacagccgcttccctgttggggct
gccctgctcaccggggacgggaggatcttctctgggtgcaacgtagaaaacgcctgctac
ccacttggtgtgtgtgccgagcggaccgccatccagaaggccatctctgaaggctacaag
gatttcagggctattgccattgccagtgacttgcaagaagagttcatctctccctgcgga
gcctgccgacaagtcatgagagagtttggcaccaactgggctgtgtacatgaccaagccc
gatggcacattcgtagtgaggacggtccaggagctgctgccggcctcgtttgggcctgaa
gacttgcagaagattcactga

DBGET integrated database retrieval system