KEGG   Rattus norvegicus (rat): 100909937Help
Entry
100909937         CDS       T01003                                 

Definition
(RefSeq) olfactory receptor 149-like
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    100909937
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    100909937
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    100909937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 100909937
NCBI-ProteinID: XP_003749307
RGD: 6500980
Ensembl: ENSRNOG00000049978
UniProt: D4A8K9
Position
2q24
AA seq 311 aa AA seqDB search
MSNLSIVTQFILLGIPHTEGVETMLFVLFLSFYIFTLVGNVLILLTIVSSNRLHTPMYFF
LCQLSVCDIFFPSVSSPKMLFYLSGNSRAISYAGCVCQLFFYHFLGCTECFLYTVMAYDR
FIAICFPLRYSIIMNHRVCAILAVGTLFFGCIQATFLTALTFQLPYCGPNEVEYYFCDIP
VMLKLACADTSALEMVGLISVGLMPLSCFLLILTSYSFILCSILQIRSTEGRHRAFSTCS
AHLAAILLAFMPVVLIYLQPTPNPWLNAAVQVLNNLVTPMLNPLIYSLRNKEVKCSLKKV
LQQALILSKRR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatctctcaatagtgactcagtttatccttctgggaatcccccacacagagggt
gtggagaccatgctctttgtcctatttttgtctttctacatctttaccctagttggaaat
gtgctcattcttctcactattgtctcctccaatcggcttcacacacccatgtacttcttc
ctgtgccagctgtcagtgtgtgacatatttttcccttctgtgagctctcccaaaatgctg
ttctacctctcaggaaatagcagagccatctcctatgcaggctgtgtgtgccagctcttc
ttctaccattttcttggttgtactgagtgtttcttgtacacagtgatggcctatgaccgt
tttattgccatatgcttccctctaaggtactcaataatcatgaaccacagggtatgtgcc
attttggccgtggggacattattttttggctgtattcaagctacttttctgactgctctt
accttccagttgccctattgtgggcccaatgaggtggaatattatttctgtgatatccct
gtgatgctaaagctggcttgtgcagacacatcagcactggagatggtggggctcatcagt
gtgggcctgatgccccttagctgcttcctcctcatcctcacctcttacagcttcatcctt
tgctctattctgcagatccgctctactgaggggcggcacagagccttctctacttgcagt
gcccatcttgctgccatcctccttgccttcatgccagtggtcctcatatacctccagcct
accccaaatccctggctcaatgcagctgttcaggtcttgaataacctcgtgacacctatg
ctgaatcctttgatctatagcctcagaaataaggaagtaaaatgttctctaaagaaagtg
ctacagcaagcgcttattctgtctaaaaggagatag

DBGET integrated database retrieval system