KEGG   Rattus norvegicus (rat): 100909966Help
Entry
100909966         CDS       T01003                                 

Definition
(RefSeq) olfactory receptor 6F1-like
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    100909966
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    100909966
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    100909966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 100909966
NCBI-ProteinID: XP_003748964
RGD: 6500576
Ensembl: ENSRNOG00000032371
UniProt: D3ZQU0
Position
1q32
AA seq 308 aa AA seqDB search
MITENGTLSQGFLLLGFPGSQVLQTSLFLFFLVMYLLTIGGNVAILLLVSTSHQLQTPMY
FFLSNLSFLEIWYTTAAVPKALAILVGRSQTISFSGCLLQMYLVFSLGCTEYFLLAAMAY
DRYLAICFPLHYQVIMNSLLSAQLALCSWICGFLAISVPAALISTLSFCGTHSINHFFCD
IAPWIALACTSTQGVETVAFVIAFVVILSSCLITLISYAYIIRTILRIPSTSGRRKAFST
CSSHLTVVLIWYGSTIFLHVRTSIKDDLQLTKAVHVLNTVVTPALNPFIYTLRNKEVREI
LEKKWKRM
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagagaatgggactctatcccaaggcttccttctgttaggctttcctggatct
caggtcctccaaacttctctttttctcttttttctggtgatgtacctcctcaccattgga
ggtaatgtggcaatcttgctattggtcagtacttcccatcagttacagacccctatgtat
ttctttctgagcaatctgtcattcttggagatctggtacaccacagctgcagtccctaaa
gctctggccattctggtggggaggagccagaccatatcattttcaggttgccttttgcag
atgtacttggttttctctttaggttgcacagaatactttctcttggcagccatggcttat
gaccgctaccttgccatctgttttcctctacattaccaggttatcatgaacagcctgctc
tcagcacagctggctctttgctcctggatttgtggtttcctggccatttctgtgccggca
gcccttatcagcaccttgtccttctgtggcacccattccatcaatcatttcttctgtgac
attgcaccctggattgccctggcctgtaccagtacacaaggagtggagacagtggctttt
gtgattgcttttgtggttatcctgagttcctgtctcattactctgatctcttatgcctac
atcatcagaaccatcctgaggatcccctcaaccagtggccgcagaaaagctttctccacc
tgttcctcccacctcactgtggtactcatctggtatgggtctacaattttcctccatgtt
cgaacatctatcaaagatgatttgcaactgactaaagctgttcatgtcctcaatacagtg
gtgactccagctctaaatcccttcatttatacccttcgtaacaaagaggtcagagaaatt
ctggagaagaaatggaagagaatgtga

DBGET integrated database retrieval system