KEGG   Rattus norvegicus (rat): 100910068Help
Entry
100910068         CDS       T01003                                 

Definition
(RefSeq) lymphocyte antigen 6K-like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Toxin_TOLIP UPAR_LY6
Motif
Other DBs
NCBI-GeneID: 100910068
NCBI-ProteinID: XP_008763841
RGD: 6500491
Ensembl: ENSRNOG00000025725
UniProt: D3ZNV7
Position
7q34
AA seq 179 aa AA seqDB search
MEGPKGTLRHGLPRKTRHPLEMVILLALLIAVGLPLVKTNVDDEEEKITCHVCESESNLN
CSNPKACDSGKKFCLLAVTRIFERFFYVSKQCTQLCPTPPLFFAETPSEPKGFLVEKPLP
FLFVKCCKWDLCNEKFPVSITMLKQESGKASERRHRYTELLLPGFMVLTANGLSALSLL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggagggacccaagggcacgctgaggcacgggctgccgagaaagactaggcatcctctg
gagatggtgatcctactggccttgctcatagctgtgggcttaccgttggtgaagaccaac
gtggatgacgaggaggagaagatcacctgtcacgtttgtgagtctgagagcaaccttaac
tgctcgaatccaaaggcctgtgattctggcaaaaagttctgtttgttggctgtcacacga
atattcgaacgtttcttctacgtgtcaaaacagtgcacccaattgtgtccaaccccccca
cttttttttgctgaaacaccatctgagcctaaggggtttctggtcgaaaagcccttgccc
ttcttatttgtaaagtgctgtaaatgggacttatgtaatgaaaagtttccagtctccatc
actatgctcaaacaagagtctggaaaagccagtgagagaagacatagatacactgagctg
ttactgcctggcttcatggtccttactgctaatggcctctcagccctcagcctgctgtaa

DBGET integrated database retrieval system