KEGG   Rattus norvegicus (rat): 100910144Help
Entry
100910144         CDS       T01003                                 

Gene name
Ces2
Definition
(RefSeq) carboxylesterase 2
  KO
K03927  carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100910144 (Ces2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100910144 (Ces2)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     100910144 (Ces2)
    3.1.1.84  cocaine esterase
     100910144 (Ces2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9 Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 100910144
NCBI-ProteinID: NP_001258232
RGD: 6504334
Ensembl: ENSRNOG00000036571
UniProt: O70177
Position
1q55
AA seq 561 aa AA seqDB search
MPRNQLHSWLNAVLFGLLLLLIHVQGQDSPESSPIRTTHTGQVQGKLDHVKDTKAGVHTF
LGIPFAKPPVGPLRFAPPEPPEPWSGVRDATSQPAMCLQNLDILDEVGLLDMKMILSSIS
MSEDCLYLNVYAPAHAREGSNLPVMVWIHGGALVVGMASMYDGSLLTVNEDLVVVTIQYR
LGVLGFFSTGDEHARGNWGYLDQVAALRWVQQNIAHFGGNPNRVTIFGESAGGTSVSSHV
ISPMSQGLFHGAIMESGVALLPDLISETSETVSTTVAKLSGCEAMDSEALVRCLRAKSGA
EILVINKVFKMIPAVVDGEFLPRHPKELLASEDFHPVPSIIGVNTDEYCCTIPMVMGTAQ
IIKELSRENLQAVLKDTAAQMMLPPECGDLLMEEYMGNTDDSQTLQIQYTEMMGDFLFVI
PALQVAHFQRSHAPVYFYEFQHAPSYFKNVRPPHVKADHADEVPFVFGSFFSGMKLDFTE
EERLLSRRMMKYWANFARQGNPNSEGLPYWPALDHDEQYLQLDTHPAVDRALKARRLQFW
TKTLPQKIEELNGAQKNHAEL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgccacggaaccaactgcatagctggctgaatgctgtgctctttgggctgctgcttctt
cttattcatgtgcagggtcaggactcaccggagtccagccccatcaggaccacacacact
ggccaggtccaaggcaagctcgaccacgtgaaggacactaaagctggtgtccacaccttc
ctgggaattccctttgccaagcctcctgtaggaccgctgcgctttgcacctcctgagcca
cctgagccatggagtggtgtgagagatgcgacctcacagccggccatgtgtctgcaaaat
cttgatattctggatgaagtaggcctgctggatatgaaaatgatactgtcttccatttct
atgtctgaggactgcctgtatctcaatgtctatgcaccagcccatgcccgtgagggctct
aacctgcctgtgatggtgtggatccacggaggtgcgctggttgtaggaatggcttccatg
tatgatggatctctattgacagtcaatgaggacttggtggttgtcactattcagtatcgt
ctgggtgtcctgggctttttcagcactggagatgagcacgccagaggcaactggggatac
ctggaccaagtggctgccctacgttgggtccagcagaatatcgcccattttggaggcaac
cctaaccgtgtcactatctttggcgagtctgcaggtggcacaagtgtgtcttcacatgtt
atatcccccatgtctcaagggctcttccatggtgccatcatggagagtggagtggccctg
ctgcctgaccttatctctgaaacctctgaaacggtctccactacagtggccaagctctct
ggatgtgaggctatggactcagaggccctggtgcgctgcctgagagcgaagagtggagca
gagattctggtcattaacaaggtcttcaagatgatccccgctgtggtggatggagagttc
ctacccaggcatcccaaagagctgttggcatctgaggattttcaccctgtccccagcatc
attggtgttaacacagatgagtactgttgcaccattcctatggtcatgggcactgctcaa
ataataaaggagctatccagagagaacctgcaggctgttctaaaggatacagcagcacaa
atgatgcttcctcctgagtgtggtgacctgctcatggaagagtacatggggaacactgat
gattcccagaccctacaaatacagtacacagagatgatgggagacttcctgtttgtgatc
cctgcactccaagtagcacactttcagcgttcccatgcccctgtctacttctatgagttc
caacatgcacccagctatttcaagaatgtcaggccaccccacgtgaaggctgaccatgct
gatgaggttccttttgtctttgggtccttcttttcgggcatgaaacttgacttcactgag
gaggagaggctgctgagcaggaggatgatgaagtactgggccaactttgcaagacagggg
aaccccaacagcgagggtctaccctactggcctgcattggaccacgatgagcagtacctg
cagttggacacccatcctgctgtggaccgagccctgaaggccagaaggctgcagttctgg
accaagactctgccccagaagattgaggagctaaatggagctcagaaaaaccatgcagag
ctgtag

DBGET integrated database retrieval system