KEGG   Rattus norvegicus (rat): 100910163Help
Entry
100910163         CDS       T01003                                 

Definition
(RefSeq) uncharacterized LOC100910163
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: TC1 tRNA_bind_2 HalOD1
Motif
Other DBs
NCBI-GeneID: 100910163
NCBI-ProteinID: XP_003751670
RGD: 6499724
Ensembl: ENSRNOG00000047977
UniProt: B0BND1
Position
16q12.5
AA seq 106 aa AA seqDB search
MKAKPSHPATSMSTSLRVSPSIHGYHFDTAARKKAVGNIFENIDQESLQRLFRNSGDKKA
EERAKIIFAIDQDLEEKTRALMALKKRTKDKLLQFLKLRKYSIKVH
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaaaaccaagccacccagccaccagcatgtccacttctcttcgagtaagcccg
tccatccacggctaccacttcgacacagctgctcgcaagaaagctgtgggtaacatcttt
gaaaacatagaccaggagtccctgcagaggctcttcaggaactcgggagacaagaaggca
gaggagcgggccaagatcattttcgccatcgaccaagatttggaggagaaaactcgagcc
ctcatggccctgaagaagaggacaaaagacaagcttctccagttcctcaaactgcggaaa
tactccatcaaggtacactga

DBGET integrated database retrieval system