KEGG   Rattus norvegicus (rat): 100910526
Entry
100910526         CDS       T01003                                 

Gene name
sultK1
Definition
(RefSeq) sulfotransferase 1C2-like
  KO
K01025  sulfotransferase [EC:2.8.2.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100910526 (sultK1)
Enzymes [BR:rno01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     100910526 (sultK1)
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3 Syntaxin
Other DBs
NCBI-GeneID: 100910526
NCBI-ProteinID: XP_006244316
RGD: 6497849
Ensembl: ENSRNOG00000050885
Vega: OTTRNOG00000001264
UniProt: F1LZL1
Position
9q11
AA seq 296 aa
MALAPELSRQTKLKEVAGIPLQAPTVDNWSQIQTFKAKPDDLLICTYPKSGTTWIQEIVD
MIEQNGDVEKCQRTIIQHRHPFIEWARPPQPSGVDKANAMPAPRILRTHLPTQLLPPSFW
TNNCKFLYVARNAKDCMVSYYHFYRMSQVLPDPGTWNEYFETFINGKVSWGSWFDHVKGW
WEIRDRYQILFLFYEDMKRDPKREIQKVMQFMGKNLDEEVVDKIVLETSFEKMKENPMTN
RSTVPKSVLDQSISPFMRKGTVGDWKNHFTVAQNDRFDEIYKQKMGGTSLNFCMEL
NT seq 891 nt   +upstreamnt  +downstreamnt
atggccctggccccagaattgagcagacagacaaaactgaaagaggtcgcagggatccca
ctgcaggctccaactgtcgacaactggagtcagattcagaccttcaaggcgaagccagat
gacctcctcatctgtacttaccctaaatcagggacaacatggattcaagaaattgtcgac
atgattgagcagaatggggatgtagagaagtgccagaggaccatcattcaacaccgacac
ccttttattgagtgggctcggccaccccaaccatcaggtgtggacaaagccaatgcgatg
ccagctccaaggatattaaggacccatcttcccactcagctgctgccaccgtctttctgg
acaaacaactgtaagttcctttatgtggctcgaaatgccaaagactgcatggtttcctac
taccacttctacaggatgagccaggtgctccccgatccaggcacctggaatgagtatttt
gaaaccttcatcaatggaaaagtaagttggggatcttggtttgaccatgtgaaaggatgg
tgggaaattcgagacagataccagattctctttctcttctatgaagatatgaagagggac
ccaaagcgtgaaatccagaaggtaatgcagttcatgggcaagaatttggatgaagaggtc
gtggataaaatagtcctggagacatcgtttgagaaaatgaaagagaatcctatgacaaat
cgttctacagtccccaagtctgtcctggaccagtccatttcccctttcatgagaaaagga
actgtgggtgattggaaaaaccactttactgtagctcagaatgacaggtttgatgaaatc
tataagcaaaagatgggcggaacctctctaaacttctgcatggaactctga

DBGET integrated database retrieval system