KEGG   Rattus norvegicus (rat): 100910554
Entry
100910554         CDS       T01003                                 

Definition
(RefSeq) histone H2A type 1-like
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100910554
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100910554
  09165 Substance dependence
   05034 Alcoholism
    100910554
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100910554
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100910554
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100910554
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100910554
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Other DBs
NCBI-GeneID: 100910554
NCBI-ProteinID: XP_003751759
RGD: 6497956
Ensembl: ENSRNOG00000051758
UniProt: M0RCL5
Position
17p11
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGSYSERVGAGAPVYLAAVMEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESYHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggacgcggcaagcagggcggcaaggctcgcgccaaagccaagacccgttcttca
cgggccggcctgcagttcccggtgggtcgcgtgcaccgtctgctccgaaagggcagctac
tctgagcgcgtgggcgccggcgccccggtgtacctggcggccgtgatggagtacctgacg
gccgagatcctggagctggcgggcaacgctgcgagggacaacaagaagactcgcatcatc
ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaaactgctgggccgt
gtgaccatcgcgcagggcggcgtcctgcccaacatccaggcggtgctgctgcccaagaag
acggagagctaccacaaggctaaggggaagtaa

DBGET integrated database retrieval system