KEGG   Rattus norvegicus (rat): 100910678Help
Entry
100910678         CDS       T01003                                 

Definition
(RefSeq) coiled-coil domain-containing protein 72-like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: TMA7
Motif
Other DBs
NCBI-GeneID: 100910678
NCBI-ProteinID: XP_003749791
RGD: 6497475
UniProt: D3ZP49
Position
4q24
AA seq 64 aa AA seqDB search
MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAEGKGPLATGGIKK
SGKK
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggccgcgaaggtggcaaaaagaagcccctgaaacagcccaagaagcaggccaag
gagatggacgaggaagataaggctttcaagcagaaacaaaaggaggaacagaagaaactc
gaggagctaaaagccaaggccgaggggaagggtcccctggctacaggtggaattaagaaa
tctggcaaaaagtaa

DBGET integrated database retrieval system