KEGG   Rattus norvegicus (rat): 100910696Help
Entry
100910696         CDS       T01003                                 

Definition
(RefSeq) olfactory receptor 14J1-like
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    100910696
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    100910696
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    100910696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 100910696
NCBI-ProteinID: XP_008770906
RGD: 6496820
Position
20p12
AA seq 323 aa AA seqDB search
MTAKNITTMSGFLLKGFSDNHELQILQALFFLVTYLLGSAGNFIIITITTLDXTLQSPMY
YFLKHLSILDLSSLSVTVPQYVYSSLAQSGYISYGQCMMQVFFFTALAWSEMAILTVMSY
DRYVAICLPLHYEVIMSPRKCTWAVAAVWLSGSISGTLYTASTLSIRFCGDKIIHQFFCD
VPQLLKISCSNDYFGVLGVSTFMTVLAFACFVGIAFSYGQIFSTVLRIPSAEGRSKVFST
CLPHLFVVSFFLSTGICAYLKPTSDSPTALDLILSIFYTVLPPTLNPVIYSLRNASLKGA
VKKLLLSEEFIGKNYFCSVIHAC
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaaaaacataaccacaatgagtggattcctcctcaaggggttctctgacaac
catgaacttcagatcttacaggctttgttcttcttggtgacatatctattgggctcagca
ggtaacttcatcattatcaccatcacaacactggacnccacactccagtctccaatgtat
tactttctgaagcacctttccattctggacctctcatccctctctgttacagttccccag
tatgtttatagttcactggcacaaagtggctacatttcatatggacagtgcatgatgcag
gtttttttcttcacggctttggcctggagtgaaatggccattctcacagtgatgtcttat
gaccgctatgtggccatctgcctcccactgcactatgaggtcatcatgagtcccagaaag
tgcacttgggctgtggcagctgtgtggctaagtggaagcatctcaggaacgttatacaca
gcaagtacactctctatcagattctgtggggacaagataattcaccagttcttctgtgat
gtcccccagttgctcaagatctcttgctctaatgactactttggggtactgggagtgtct
actttcatgactgtattagccttcgcttgcttcgtggggattgccttctcctatggccag
atattctctacagttctcaggattccctctgcagaaggtcgatctaaggtcttctctacc
tgcctgccccatctctttgttgtttcattttttctctcaacaggcatttgtgcctatcta
aagccaacctcagactcaccaactgctttagacctcatactctctattttttacactgtt
ctacccccaaccctcaaccctgttatctatagcctgagaaatgcgtccttgaagggagct
gtaaagaagttgctgttaagtgaggaattcattgggaaaaattatttttgttctgttatt
catgcctgctaa

DBGET integrated database retrieval system