KEGG   Rattus norvegicus (rat): 100910732
Entry
100910732         CDS       T01003                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 2-like
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04660  T cell receptor signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05170  Human immunodeficiency virus 1 infection
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100910732
   04012 ErbB signaling pathway
    100910732
   04014 Ras signaling pathway
    100910732
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100910732
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100910732
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100910732
  09158 Development and regeneration
   04360 Axon guidance
    100910732
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100910732
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100910732
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    100910732
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100910732
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE20 family
   100910732
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo zinc-ribbons_6
Other DBs
NCBI-GeneID: 100910732
NCBI-ProteinID: XP_003751114
RGD: 6497075
Ensembl: ENSRNOG00000001747
UniProt: Q64303
Position
11q22
AA seq 524 aa
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSST
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNTKGSETSAVVTEEDDDDEDAAP
PVIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDSGAKSSDKQKKKAKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtctgataacggggagctagaggacaagcccccagcacctccagtgcggatgagcagc
accatttttagcactggaggaaaggatcctttatcagccaatcacagtttgaagcctttg
ccttctgttccagaggaaaaaaaaccgaggaacaaaatcatctccatattctcaagcaca
gaaaaaggaagtaaaaagaaagaaaaagaacggccagagatttctccgccgtctgatttt
gagcataccatccatgttggctttgatgctgttacgggagagttcactggcatgccagag
cagtgggcacggctgttgcagacctccaacattaccaaactggagcagaagaagaacccg
caggctgtgctggatgtcttgaagttctacgactccaacactgtgaagcagaagtacctg
agcttcactcctcctgagaaagatggctttccttctggaacaccagcactgaacaccaag
gggtcagagacatcagctgtggtgacagaggaagacgatgacgatgaagatgctgctcct
cccgtcattgcccctcggccagatcatacaaaatcaatctacacaaggtctgtcatcgac
cctattcctgctccagttggtgactctaatgtcgacagtggtgccaagtcttcagacaaa
cagaaaaagaaagccaagatgaccgatgaagagattatggagaaattaagaactattgtg
agcataggtgaccctaagaaaaaatacacaagatatgaaaaaatcgggcaaggggcttct
ggtacagtttttactgcaactgatgtggccctggggcaagaggttgctatcaagcagatt
aatttacagaaacaaccaaagaaggaattgatcattaatgaaattctggtgatgaaagag
ttaaagaatcccaacatagttaacttcttggacagttacctggtaggagacgagttgttt
gtggtaatggagtaccttgctggtgggtccctcactgatgtcgtgacagaaacctgcatg
gatgaagcgcagatcgcagctgtgtgcagagagtgtttacaggcgttggagtttttacat
gctaatcaagtgatccacagagacatcaaaagtgacaatgtgcttttgggaatggaaggc
tcagttaaactcactgattttggcttctgtgcccagatcacccctgaacagagcaaacgc
agtactatggttggaacaccatactggatggcaccggaggtagtcacgcggaaagcctat
ggccccaaagttgacatatggtctctgggcatcatggctatcgaaatggtggaaggagag
cctccatacctcaatgaaaatcctttacgggcattatacctgatagcaacgaatggaaca
cctgagctccagaatccagaaaaactttcccccatatttcgggatttcttaaatcggtgt
ttggaaatggatgtggagaagaggggttcagccaaagaactattacagcatcctttcctg
aaactggccaaaccattatccagcttgacgcctctgatcctggcagctaaagaagcaatg
aagagtaaccgctaa

DBGET integrated database retrieval system