KEGG   Rattus norvegicus (rat): 100910813
Entry
100910813         CDS       T01003                                 

Gene name
Lyg2, RGD1559649
Definition
(RefSeq) lysozyme G2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: SLT
Other DBs
NCBI-GeneID: 100910813
NCBI-ProteinID: XP_008765288
RGD: 6496811
Ensembl: ENSRNOG00000050591
UniProt: M0R6U6
Position
9q21
AA seq 213 aa
MVPSVVFWGLIALIGTARGSYPGFTHSTNPHVHSRLYHGCYGDVMTMETFGAPCDINNLM
NCGIHGSEMFAEMDLKAIKPYRILIKEVGQRHCIDPALIAAIISRESHGGAVLQNGWDHK
GQRFGLMQLDKNMYHPIGSWDSKEHLLQSVGILTERIKALKRKFPTWNAAQHLKGGLTAF
KSGMETIVTPADIEGDLVDDIIARAKFYKRHGF
NT seq 642 nt   +upstreamnt  +downstreamnt
atggtaccctcggtggtgttctggggacttattgctctcattggcactgccaggggctca
tatcctgggttcactcactccacaaaccctcatgtgcactctcgtctataccatggctgc
tacggagatgtcatgaccatggagacttttggggctccctgtgacataaacaatctgatg
aattgtgggatccacggttctgaaatgtttgccgagatggacttgaaagccataaagcct
taccggatcctcatcaaagaagtgggacagaggcactgcatcgacccagccctcatcgct
gccatcatctccagggaaagccacggcggggctgtcctgcaaaatggctgggaccataaa
ggacagaggtttggcttgatgcagcttgataaaaacatgtaccatcctattggttcctgg
gacagcaaggaacaccttctacagtctgttgggattctgacagaaagaattaaggcactg
aagaggaaatttcctacctggaatgcagctcagcacctgaaaggtggtctgactgctttt
aagtcggggatggaaactattgtcactcctgcagacatagaaggcgacttagtggatgac
atcattgcccgtgccaaattctataaaagacatggcttctag

DBGET integrated database retrieval system