KEGG   Rattus norvegicus (rat): 100910867Help
Entry
100910867         CDS       T01003                                 

Gene name
Cfap69, MGC72627
Definition
(RefSeq) cilia and flagella associated protein 69
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 100910867
NCBI-ProteinID: XP_003749736
RGD: 6496360
Ensembl: ENSRNOG00000006114
UniProt: D4A7D1
Position
4q13
AA seq 941 aa AA seqDB search
MSTAEASAVAADAAEVGGRTKTGSPRTIPVFGVAIPDGEMQDIFKPMDLNRIIKLLEEDD
KDVSEEKQLKYIKKLTHCYQNGFPLRDLAQIFKILSLCAEKIEKQPCFVEPASEIIKLCG
LPFLKKKVSDEITYTEDTANSFALLGELMKIPSSKLRIQICKCIVDFYHAEPLKKHISGY
QQVSSSFKIKMVEVGGLAKAMVQSALLLENQLVEKLWVLKVLQHLSTSGVNCTLMVKAQA
ASRICAHLNDPDPSGQLLFRSSEVLWNLLEKSSKEEIIQQLSNLECLLTLKEVFKNLVMR
GHSHYERQLRNDILVITTIIAQNPGAPMIECGFTRDLILFATFNEVKSQNPLVKSLKLFN
CYEDFELKKLLFNIIVILCKDLTTVQLLIDGKVILALLTYVKKPERLKIIEWSAAQYEEL
QLHAIATLSSVAPLLIEEYMSCHGNARILAFLEWCGHEDSYFIHGNSFHGTGGRGNKFAQ
MRYTLRLLRAMVYLEDETVNKDLCERGVIHQLIEIFKTMMSRPAEKEEAIALEIQSDTLL
ILSGLCENYIQRKEMFGTEGVDIVLHVMKTDPKNLQRGLGYNVLLFSTLDSIWCCILGCY
SSEDYFLEKEGIFLLLDILALNQKKFCNLILGIMVEFCDNPKTSAHVNAWRGKKDLTAAS
LLIKLWRKEEKELGVKRDKNGKIVDTKRPLFTSFQEEQKIVPLPANCPSIAVMDVAENIR
AKIYAVLDKLDFENLPGLSAEDFVTLCIIHRYLDFKIGEIWTEVSEEIKLEKLRLVTVDE
KSLHSIIAATENIGKMVASLQSEMIENQALQDVQNEQRVYAKIQATHKQRDQAHKSWENF
LARTSNAKTLKKAKRLQEKAIESSRYSKRPQNAIFHQTVIKGLNTTVTSGQVVTVESTPT
RLLGGPLADTDIALKKLPIRGGALQKVKVKPLDGLKKTVPI
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgcggaggcctctgccgtggcggccgacgccgccgaggtgggcggcaggacg
aagaccggcagtccccgcacaatcccggtgtttggggtggcgatcccggatggggagatg
caggatattttcaagcctatggaccttaatcgtatcatcaagctcctggaagaggatgat
aaggatgtctcagaagaaaaacaactgaagtatatcaagaaactgacacactgttatcag
aatggatttcctctaagagatttggcacagatatttaaaattctgagtctgtgtgcagaa
aaaatcgaaaagcagccatgttttgtagagcctgcatctgaaatcataaaattgtgtggc
ttgccatttttgaaaaagaaagtatcggatgaaataacttacactgaagataccgctaac
tcatttgcacttctgggtgaattaatgaaaataccaagttctaaattaaggatacaaatc
tgtaagtgtattgttgacttctatcatgcagaaccactaaagaaacacatttcaggctac
cagcaagttagctcatcattcaagattaaaatggtagaggtcggaggattagcaaaagca
atggtccagtctgcactcctgcttgagaatcagcttgttgagaaactctgggttcttaaa
gttctgcagcatctctctacttctggagttaactgcactttgatggtgaaagcccaagca
gccagcagaatctgtgctcacctcaacgacccggatccctcaggacagcttttgtttcgt
tcatcagaagtactgtggaatttattggaaaaatcttcaaaggaggaaattatacagcag
ctcagtaacttggaatgcctgctgactttgaaggaagtatttaaaaatctggttatgagg
gggcatagtcactatgagcgtcagcttagaaatgatatattagttatcaccacaattata
gctcagaaccctggagcaccaatgattgaatgtggctttaccagggatttgattctattt
gcaacttttaatgaagttaaaagtcaaaatcctttggtaaaaagtcttaagctttttaat
tgctatgaagattttgaactgaagaaattgctattcaatataattgtgatcttgtgtaaa
gatttaactactgtacagcttttaatcgatggcaaagttattttggctttgttgacctat
gtaaaaaagcctgagagactcaaaattattgagtggtctgcagcacagtatgaagaacta
caactgcatgcaattgccaccttgtcctcagtggctcctttgttaatagaggagtacatg
tcatgccacggcaatgctcggatccttgcgtttttagaatggtgtgggcatgaggattcc
tacttcattcatggcaacagtttccatggtacagggggccgtggaaacaagtttgcacag
atgcgttacactttaagactcctcagagccatggtttatcttgaagatgagactgtgaac
aaggacctttgtgaaaggggggttattcatcaactgatagaaatctttaaaactatgatg
agcagacctgctgagaaggaagaggccattgccttagaaatccagtctgacacattactt
attctgtcaggtctttgtgagaattatatccagaggaaggaaatgttcggaactgaagga
gttgacatagttctccacgtaatgaaaacagaccccaagaatttacagaggggcttaggc
tacaacgtccttcttttcagtacattagacagcatttggtgctgtattttggggtgttat
tcttctgaagattattttcttgaaaaggaagggatttttctccttttggatattctggca
ttgaaccaaaaaaaattctgtaatctgattcttggaataatggttgaattttgtgataat
cccaaaacttctgctcatgtcaatgcttggcgcgggaagaaagacctgactgctgctagt
cttttgattaaactgtggagaaaagaggaaaaagagctaggagtaaaacgtgacaagaat
ggcaagatcgttgatacaaagagacctctatttactagttttcaagaagaacaaaagatc
gtgccccttcctgctaactgcccatccattgcggttatggatgttgctgaaaatatcaga
gcaaaaatttatgctgtgttggataaactagattttgaaaacttaccaggcttatctgct
gaagattttgtcaccctctgtataatacatagatatcttgattttaaaattggagaaata
tggactgaagtgtctgaagaaataaagttggaaaagttaagactagtcactgtagatgaa
aaatccttgcactctattatagcagcaacagagaatattggaaagatggttgcttccttg
caaagtgagatgatcgaaaaccaagcactccaggatgtgcaaaatgaacaaagagtatat
gcaaaaatacaagctacacataagcagagagatcaggctcacaagtcatgggaaaacttc
ttggctagaacatcaaatgctaaaacattaaagaaagcaaagagacttcaagaaaaggcc
atagaatcctccagatacagcaaacgaccacaaaatgcaatattccaccaaacagttatt
aaaggccttaacacaacggtaacttcgggccaggtggtgacagtggaaagcactcctact
cgattgctgggaggacctctggctgacacagacattgctcttaaaaaactgcctattcga
ggaggagccttgcagaaggtgaaagtgaagccgctggatggccttaaaaagaccgtcccg
atctga

DBGET integrated database retrieval system