KEGG   Rattus norvegicus (rat): 100910867
Entry
100910867         CDS       T01003                                 

Gene name
Cfap69, MGC72627
Definition
(RefSeq) cilia and flagella associated protein 69
  KO
K24227  cilia- and flagella-associated protein 69
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100910867 (Cfap69)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    100910867 (Cfap69)
SSDB
Other DBs
NCBI-GeneID: 100910867
NCBI-ProteinID: XP_003749736
RGD: 6496360
Ensembl: ENSRNOG00000006114
UniProt: D4A7D1
Position
4q13
AA seq 941 aa
MSTAEASAVAADAAEVGGRTKTGSPRTIPVFGVAIPDGEMQDIFKPMDLNRIIKLLEEDD
KDVSEEKQLKYIKKLTHCYQNGFPLRDLAQIFKILSLCAEKIEKQPCFVEPASEIIKLCG
LPFLKKKVSDEITYTEDTANSFALLGELMKIPSSKLRIQICKCIVDFYHAEPLKKHISGY
QQVSSSFKIKMVEVGGLAKAMVQSALLLENQLVEKLWVLKVLQHLSTSGVNCTLMVKAQA
ASRICAHLNDPDPSGQLLFRSSEVLWNLLEKSSKEEIIQQLSNLECLLTLKEVFKNLVMR
GHSHYERQLRNDILVITTIIAQNPGAPMIECGFTRDLILFATFNEVKSQNPLVKSLKLFN
CYEDFELKKLLFNIIVILCKDLTTVQLLIDGKVILALLTYVKKPERLKIIEWSAAQYEEL
QLHAIATLSSVAPLLIEEYMSCHGNARILAFLEWCGHEDSYFIHGNSFHGTGGRGNKFAQ
MRYTLRLLRAMVYLEDETVNKDLCERGVIHQLIEIFKTMMSRPAEKEEAIALEIQSDTLL
ILSGLCENYIQRKEMFGTEGVDIVLHVMKTDPKNLQRGLGYNVLLFSTLDSIWCCILGCY
SSEDYFLEKEGIFLLLDILALNQKKFCNLILGIMVEFCDNPKTSAHVNAWRGKKDLTAAS
LLIKLWRKEEKELGVKRDKNGKIVDTKRPLFTSFQEEQKIVPLPANCPSIAVMDVAENIR
AKIYAVLDKLDFENLPGLSAEDFVTLCIIHRYLDFKIGEIWTEVSEEIKLEKLRLVTVDE
KSLHSIIAATENIGKMVASLQSEMIENQALQDVQNEQRVYAKIQATHKQRDQAHKSWENF
LARTSNAKTLKKAKRLQEKAIESSRYSKRPQNAIFHQTVIKGLNTTVTSGQVVTVESTPT
RLLGGPLADTDIALKKLPIRGGALQKVKVKPLDGLKKTVPI
NT seq 2826 nt   +upstreamnt  +downstreamnt
atgtccaccgcggaggcctctgccgtggcggccgacgccgccgaggtgggcggcaggacg
aagaccggcagtccccgcacaatcccggtgtttggggtggcgatcccggatggggagatg
caggatattttcaagcctatggaccttaatcgtatcatcaagctcctggaagaggatgat
aaggatgtctcagaagaaaaacaactgaagtatatcaagaaactgacacactgttatcag
aatggatttcctctaagagatttggcacagatatttaaaattctgagtctgtgtgcagaa
aaaatcgaaaagcagccatgttttgtagagcctgcatctgaaatcataaaattgtgtggc
ttgccatttttgaaaaagaaagtatcggatgaaataacttacactgaagataccgctaac
tcatttgcacttctgggtgaattaatgaaaataccaagttctaaattaaggatacaaatc
tgtaagtgtattgttgacttctatcatgcagaaccactaaagaaacacatttcaggctac
cagcaagttagctcatcattcaagattaaaatggtagaggtcggaggattagcaaaagca
atggtccagtctgcactcctgcttgagaatcagcttgttgagaaactctgggttcttaaa
gttctgcagcatctctctacttctggagttaactgcactttgatggtgaaagcccaagca
gccagcagaatctgtgctcacctcaacgacccggatccctcaggacagcttttgtttcgt
tcatcagaagtactgtggaatttattggaaaaatcttcaaaggaggaaattatacagcag
ctcagtaacttggaatgcctgctgactttgaaggaagtatttaaaaatctggttatgagg
gggcatagtcactatgagcgtcagcttagaaatgatatattagttatcaccacaattata
gctcagaaccctggagcaccaatgattgaatgtggctttaccagggatttgattctattt
gcaacttttaatgaagttaaaagtcaaaatcctttggtaaaaagtcttaagctttttaat
tgctatgaagattttgaactgaagaaattgctattcaatataattgtgatcttgtgtaaa
gatttaactactgtacagcttttaatcgatggcaaagttattttggctttgttgacctat
gtaaaaaagcctgagagactcaaaattattgagtggtctgcagcacagtatgaagaacta
caactgcatgcaattgccaccttgtcctcagtggctcctttgttaatagaggagtacatg
tcatgccacggcaatgctcggatccttgcgtttttagaatggtgtgggcatgaggattcc
tacttcattcatggcaacagtttccatggtacagggggccgtggaaacaagtttgcacag
atgcgttacactttaagactcctcagagccatggtttatcttgaagatgagactgtgaac
aaggacctttgtgaaaggggggttattcatcaactgatagaaatctttaaaactatgatg
agcagacctgctgagaaggaagaggccattgccttagaaatccagtctgacacattactt
attctgtcaggtctttgtgagaattatatccagaggaaggaaatgttcggaactgaagga
gttgacatagttctccacgtaatgaaaacagaccccaagaatttacagaggggcttaggc
tacaacgtccttcttttcagtacattagacagcatttggtgctgtattttggggtgttat
tcttctgaagattattttcttgaaaaggaagggatttttctccttttggatattctggca
ttgaaccaaaaaaaattctgtaatctgattcttggaataatggttgaattttgtgataat
cccaaaacttctgctcatgtcaatgcttggcgcgggaagaaagacctgactgctgctagt
cttttgattaaactgtggagaaaagaggaaaaagagctaggagtaaaacgtgacaagaat
ggcaagatcgttgatacaaagagacctctatttactagttttcaagaagaacaaaagatc
gtgccccttcctgctaactgcccatccattgcggttatggatgttgctgaaaatatcaga
gcaaaaatttatgctgtgttggataaactagattttgaaaacttaccaggcttatctgct
gaagattttgtcaccctctgtataatacatagatatcttgattttaaaattggagaaata
tggactgaagtgtctgaagaaataaagttggaaaagttaagactagtcactgtagatgaa
aaatccttgcactctattatagcagcaacagagaatattggaaagatggttgcttccttg
caaagtgagatgatcgaaaaccaagcactccaggatgtgcaaaatgaacaaagagtatat
gcaaaaatacaagctacacataagcagagagatcaggctcacaagtcatgggaaaacttc
ttggctagaacatcaaatgctaaaacattaaagaaagcaaagagacttcaagaaaaggcc
atagaatcctccagatacagcaaacgaccacaaaatgcaatattccaccaaacagttatt
aaaggccttaacacaacggtaacttcgggccaggtggtgacagtggaaagcactcctact
cgattgctgggaggacctctggctgacacagacattgctcttaaaaaactgcctattcga
ggaggagccttgcagaaggtgaaagtgaagccgctggatggccttaaaaagaccgtcccg
atctga

DBGET integrated database retrieval system