KEGG   Rattus norvegicus (rat): 100910944Help
Entry
100910944         CDS       T01003                                 

Definition
(RefSeq) reactive oxygen species modulator 1-like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Romo1 Tim17 TCRP1
Motif
Other DBs
NCBI-GeneID: 100910944
NCBI-ProteinID: XP_006235514
RGD: 6496011
Ensembl: ENSRNOG00000045555
UniProt: D4A742
Position
3q42
AA seq 79 aa AA seqDB search
MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTM
MQSGGTFGTFMAIGMGIRC
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgccggtggctgtgggtccctacgggcagtcccagcccagctgcttcgaccgcgtgaag
atgggctttgtcatgggttgcgccgtgggtatggcggccggggccctgttcggcaccttc
tcctgtctcaggatcggaatgcggggtcgggagctgatgggcggcattgggaaaaccatg
atgcagagtggcggtacctttggcactttcatggccatcggaatgggcatacgatgctaa

DBGET integrated database retrieval system