KEGG   Rattus norvegicus (rat): 100911165
Entry
100911165         CDS       T01003                                 

Gene name
Mylk4
Definition
(RefSeq) myosin light chain kinase family member 4
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04510  Focal adhesion
rno04611  Platelet activation
rno04810  Regulation of actin cytoskeleton
rno04921  Oxytocin signaling pathway
rno04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100911165 (Mylk4)
   04020 Calcium signaling pathway
    100911165 (Mylk4)
   04022 cGMP-PKG signaling pathway
    100911165 (Mylk4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100911165 (Mylk4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100911165 (Mylk4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100911165 (Mylk4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100911165 (Mylk4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100911165 (Mylk4)
  09154 Digestive system
   04971 Gastric acid secretion
    100911165 (Mylk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    100911165 (Mylk4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     100911165 (Mylk4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100911165 (Mylk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo Kinase-like
Other DBs
NCBI-GeneID: 100911165
NCBI-ProteinID: XP_006253936
RGD: 6494757
Position
17
AA seq 656 aa
MPTPQSRAGSTGSFESGCARPGQGRCLQSQRLHCCSRSMESSLRRKDLWIVGSVCLLSSS
VFWRLFRSVAAWGGLKQAPALENAQAEENVWSNHTLNERTIVRGGRTSALTERHDQKDQF
SSEKEKITKLNKKNAEKTSGSEVQRTCVICHVERQDKIEFVQRNSTELREYAGTKDASCM
ESLEKQESNSLGYKQDTEDNNGGENGISSKEDSREIEAENRASTAASGTVLDKHSTESQH
TEDMNGVQSHERSISNIKTISTPGILGNSASGPTLQNAEQTESTGSSKRRVAEECFLSED
NKKSRIDVVGAGEESIPRTEENRQARSLDNRLQDGMTTSREQDLAVQLDDVPAPAAPFDH
RIVMAKHAAVDSLYSVSKSEILGGGRFGQVHKCEEKATGLKLAAKIIKIRGAKDKEDVKN
EISVMNQLDHVNLIQLYDAFESKHDIILVMEYVEGGELFDRIIDENCNLTELDTILFVKQ
ICEGIRYMHQMYILHLDLKPENILCVNRDAKQIKIIDFGLARRYKPREKLKVNFGTPEFL
APEVVNYDFVSFATDMWSVGVITYMLLSGLSPFLGDNDAETLTNILACRWDLEDEEFQDI
SEEAKEFISKLLIKEKSWRISASEALKHPWLSDHKLHSRLSAQKNSNSGVLNLTTK
NT seq 1971 nt   +upstreamnt  +downstreamnt
atgcccactcctcagagcagagcagggagcacagggagcttcgaaagtggctgtgctaga
ccagggcagggaaggtgcctacaaagccagagacttcactgctgctcgcggagtatggag
tcctcacttcgaagaaaagacctctggattgtgggtagcgtgtgccttctgtcgtcttcg
gtcttctggcgcctgttccggtcagtggcggcatggggaggcctcaagcaggcccctgca
cttgagaatgcacaggctgaggaaaatgtatggtccaaccacacactaaacgaaaggaca
attgtcagaggaggaaggacatcagccctcacagagagacatgaccagaaagaccagttc
tcttctgagaaagaaaagattaccaaactcaacaagaaaaatgcagagaagaccagtggc
tcagaagtgcagaggacttgcgtcatatgtcatgtggaacgacaagacaagatagaattt
gttcagaggaattccacagagctaagagagtatgcaggtacaaaagatgcgtcatgcatg
gaaagtctggagaaacaagaaagcaacagcctgggctataaacaagacactgaagacaac
aatggaggggaaaatgggatttcttctaaggaagattccagagaaatagaagctgagaac
agagcttcaacagctgcaagtggaacagtgctggacaaacactcgactgaaagccagcac
actgaggacatgaatggtgtccaatctcatgaaaggtccatcagtaatataaagaccatt
tccacaccaggaatccttggaaattcagcatcaggacccactctccagaatgctgaacag
acagagtctacgggcagcagtaagcgcagggtggcagaggagtgcttcctgagtgaggac
aacaaaaagagcagaatagatgtagtgggtgcaggggaagagtccatacccaggacagag
gaaaacagacaagccaggagcctggacaacagactccaggatggaatgaccacctctaga
gagcaagacctggcggtccaactggatgatgtccctgctcctgctgccccatttgatcat
cgcattgtaatggccaaacatgctgcagtcgacagtctgtactctgtgagcaaatccgag
attctaggaggggggcgttttggccaggttcataagtgtgaagagaaagcaacaggcctg
aagctggctgctaaaatcattaagattagaggtgcaaaggacaaggaggatgtgaagaac
gagattagtgtcatgaaccagttggaccatgtgaacctcattcagctctatgatgccttt
gagtccaagcatgacatcatccttgtcatggagtatgtggaaggcggggagctttttgac
cgcatcattgatgaaaactgcaacttgacagagctggataccatcttgttcgtgaagcag
atctgtgaggggataaggtacatgcaccagatgtacatcctccacttggatctcaagcct
gagaacatcctgtgtgtgaatcgggatgctaagcaaataaaaattattgattttggattg
gccagaagatacaagcccagagagaagctgaaggtgaactttggaaccccagaatttctt
gctcctgaagttgtgaactatgatttcgtttcctttgctacagatatgtggagtgtgggt
gtcatcacatacatgctactcagtggcttgtccccctttttgggcgataatgatgctgag
acgctgaccaacatcctggcatgccggtgggatttagaagatgaagaatttcaagatatc
tctgaggaggccaaggagttcatctccaagctcctgattaaggagaagagttggagaata
agtgccagcgaagctctcaagcacccctggttgtcagaccacaagctccactccaggctg
agtgcacagaagaactccaactctggtgttctgaacctgacgaccaaataa

KEGG   Rattus norvegicus (rat): 117558
Entry
117558            CDS       T01003                                 

Gene name
Mylk2
Definition
(RefSeq) myosin light chain kinase 2, skeletal/cardiac muscle
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04510  Focal adhesion
rno04611  Platelet activation
rno04810  Regulation of actin cytoskeleton
rno04921  Oxytocin signaling pathway
rno04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    117558 (Mylk2)
   04020 Calcium signaling pathway
    117558 (Mylk2)
   04022 cGMP-PKG signaling pathway
    117558 (Mylk2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    117558 (Mylk2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    117558 (Mylk2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    117558 (Mylk2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    117558 (Mylk2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    117558 (Mylk2)
  09154 Digestive system
   04971 Gastric acid secretion
    117558 (Mylk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    117558 (Mylk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     117558 (Mylk2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   117558 (Mylk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH
Other DBs
NCBI-GeneID: 117558
NCBI-ProteinID: NP_476557
RGD: 620934
Ensembl: ENSRNOG00000008235
UniProt: P20689
Position
3
AA seq 610 aa
MATENGAVELGTQSLSTEQTPKDAAGDGSPASEKEPSLPDTEKDLGPTNTKKDPGAPDPK
KNPDPPSLKKTPEAPGPEKKGDSAPASASNQGPSGEGDGGGGPAEGGTGPPAVLPQPTAT
ADASIQKLDATQAPSGNQESGEAKAGKKAAECREAGRRGSPAFLHSPSCPAIISCSEKTL
AMKPLSETTELIFAGVSETPDPQDPGPAKAEGGTNTLAERKEEAEAGQAEQAKVQGDTSQ
RIGFQAVPSERAEVGQALCLTAKEEDCFQILDDCPPPPAPFPHRIVELRTGNVNSEFSMN
SKEALGGGKFGAVCTCTERSTGLKLAAKVIKKQTPKDKEMVLLEIEVMNQLNHRNLIQLY
SAIETSHEIILFMEYIEGGELFERIVDEDYQLTEVDTMVFVRQICDGILFMHKMRVLHLD
LKPENILCVNTTGHLVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMW
SLGVITYMLLSGLSPFLGDDDTETLNNVLSANWYFDEETFEAVSDEAKDFVSNLITKDQS
ARMSAEQCLAHPWLNNLAEKAKRCNRRLKSQILLKKYLMKRRWKKNFIAVSAANRFKKIS
SSGALMALGV
NT seq 1833 nt   +upstreamnt  +downstreamnt
atggctacagaaaacggagcagttgagctgggaacccagagtctgtcaacagaacaaaca
cctaaagacgcagcaggtgatggatctccagcttcagagaaagaacccagcctcccagac
acagagaaagacctgggccccactaacacgaagaaagaccctggcgcgccggatccaaag
aaaaatccagatccaccctccctgaagaaaactcccgaagcccctggtccagagaaaaag
ggtgactcggccccagcttcagccagcaaccagggcccttcaggagagggtgatggaggt
gggggccctgctgaaggcggtacggggcctcctgcagtcttgccccagcccactgccaca
gctgatgccagcatccagaagctggacgccacgcaagcgccctcgggcaaccaggaatct
ggagaggccaaggcaggcaagaaggcagcagaatgccgagaagcaggacgaaggggctca
cccgcctttcttcacagccctagctgccccgcgatcatctcctgttctgagaagacactg
gccatgaagcccttaagcgagacaacagagctcatctttgcaggggtgtctgaaacccct
gatccccaagatcctggtccagctaaggcagaaggagggacgaacacgctggcagagcgg
aaagaagaggcagaggcaggccaggctgagcaggctaaggtgcaaggggacacctcccag
aggatcgggttccaggctgttccctcagagagagcagaggtggggcaggccctctgtctc
acggccaaggaggaagactgcttccaaattctggatgattgtccgccacccccagccccc
ttcccacacaggatcgtggagctgaggaccggaaatgtcaacagtgaattcagcatgaac
tcaaaggaggcattgggaggtggcaagtttggagctgtgtgcacctgcacggagagatcc
acaggcctcaagctggcagccaaggtcatcaagaaacagacccccaaggacaaggaaatg
gtgttgctggagatcgaggtcatgaaccagctgaaccaccgcaatttgatccagctgtac
tcagccattgagacctctcacgagatcatcctgttcatggagtacattgagggcggcgag
ctctttgagaggatcgtggatgaggactaccaactgacggaagtggataccatggtgttc
gtcaggcagatctgcgacgggatcctcttcatgcacaagatgagggtcctgcacttggac
ctcaagccagagaacatcctgtgtgtgaataccaccgggcacttggtgaagataattgac
ttcggcctggcaaggaggtataaccccaatgagaagctgaaggtgaattttgggaccccg
gagttcctgtcaccagaggtggtgaactatgaccagatctctgacaagacggacatgtgg
agtcttggggtgatcacctacatgctactgagtggcctctctcccttcctgggcgacgat
gacacggagaccctaaacaacgtcctgtctgccaactggtactttgatgaggagactttt
gaagctgtgtcagacgaggccaaagacttcgtttccaatcttatcacgaaggaccagagt
gccagaatgagtgctgagcagtgcctcgcccacccctggctcaacaacctggcagaaaaa
gccaagcgctgcaaccgtcgtctcaagtcccagatcctgcttaagaaatacctcatgaag
aggcgctggaagaaaaacttcattgctgtcagcgcagccaatcgcttcaagaagatcagt
agctcgggggcactgatggctttgggggtctga

KEGG   Rattus norvegicus (rat): 288057
Entry
288057            CDS       T01003                                 

Gene name
Mylk
Definition
(RefSeq) myosin light chain kinase, smooth muscle
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04510  Focal adhesion
rno04611  Platelet activation
rno04810  Regulation of actin cytoskeleton
rno04921  Oxytocin signaling pathway
rno04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    288057 (Mylk)
   04020 Calcium signaling pathway
    288057 (Mylk)
   04022 cGMP-PKG signaling pathway
    288057 (Mylk)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    288057 (Mylk)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    288057 (Mylk)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    288057 (Mylk)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    288057 (Mylk)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    288057 (Mylk)
  09154 Digestive system
   04971 Gastric acid secretion
    288057 (Mylk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    288057 (Mylk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     288057 (Mylk)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   288057 (Mylk)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig Pkinase 23ISL V-set PK_Tyr_Ser-Thr C2-set_2 fn3 Ig_4 Kinase-like Kdo DUF5898 AvrM_N TCAD9
Other DBs
NCBI-GeneID: 288057
NCBI-ProteinID: NP_001099344
RGD: 1310915
Ensembl: ENSRNOG00000002215
UniProt: D3ZFU9
Position
11
AA seq 1961 aa
MPGQLPGKTMGDVKLFASSHMSKTSHSVDPSRVSSLPLTEAPAFILPPRNLCVKEGATAK
FEGRVRGHPEPQVTWHRNGQTITNGGRFLLDGGVRGTFSLVIRGVREEDKGKYTCEASNG
SGARQVTVELTVEGDLMKKHGQPVLSKASGFPGETRPSIWGECPPKFATKLGRAVVKEGQ
MGRFSCKITGRPPPQVTWLKGNVPLQPSARVSMSEKNGMQILEIHEVTQDDMGTYTCMVV
NGSGKASMSAELSIPGLDNATRLSRGTKDPSPDIRKEVTNGISKDPETVAESKNCSSPQK
SNFLAQATNSHLKSLQQPKLKPCEDSPRKVLQSSVLQKTSSTIVLQASKVQPEVRAAGIG
ASGPGEERKSLTAPRQATPPTRQCGLGGSVGNKFITGNIPIENQRESRFPKFESQPQSQE
VTEGQTVKFTCEVSGIPKPEVGWFLEGIPVRRQEGIVEIYEDGTSHYLCLPRAGTRDSGR
YSCTASNTLGQVSCSWTLRVDRPSLTQTAPSFSSVLKDSVVIEGQDFVLRCSVRGTPAPQ
VTWLLNGQPIQFARSICEAGEAELHIQDALPEDRGTYTCLAENALGQVSCSATVTVQEKK
GEGERAHRLPPAPSKLFAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHDGNEIQ
ESEDFHFEQKGGWHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAILTVQEPHDGTQPWFI
SKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALSRDHGHFELLQNEDVFTLVLKNV
QPWHAGQYEILLKNRVGECSCQVSLMLHKGPSRVPPPRGREPASCEGLCGGGVGAHGDAD
RDGTLRPCWPARGQGWPEEEDGEDVRGLLKRRVETRLHTEEAIRQQEVGQLDFRDLLGKK
VSTKTVSEDDLKDIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTPK
TPVPEKVPPQKAATPDFRSVLGSKKKSPAENGGNTAEVLNVKAGESPTPAGNAQPVGALK
PIGNAKPAETLKSVGNAKPAETLKPVGNAKPAETLKPVGNVKPAETLKPIANAQPSGSPK
PIANAQPIETQKSVANAKSAETPKLAGKEELKEVRNDVNCKKAHVGATGNEKRPESQGSA
PVFKEKLQDVHVAEGEKLLLQCQVTSDPPATVTWTLNGKTLKTTKFIILAQEGSLFSVSI
EKALPEDRGLYKCVAKNSAGQAECSCQVTVDDAGTSENTKAPEMKSRRPKSSLTPVLGTE
SDATVKKKPASKTPTKAAMPPQIIQFPEDQKVRAGEPVELFGKVTGTQPITCTWMKFRKQ
IQESENIRVENSESGSKLTILAARQEHCGCYTLVVENKLSSRQAQVNLTVVDKPDPPAGT
PCASDIRSSSLTLSWYGSSYDGGSAVQSYNVEIWDTEDKVWTELATCRSTSFNVQDLLPD
REYKFRVRAVNVYGTSEPSQESELTAVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTVNTE
QKVSDVYDIEERLGSGKFGQVFRLVEKRTGKIWAGKFFKAYSAKEKENIRQEISIMNCLH
HPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIH
KQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEP
IGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISEDAKDFIS
NLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGR
LSSMAMISGLSGRKSSTGSPTSPINAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRD
LEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDD
AKYTCKAVNSLGEATCTAELIVETMEEGEGEEGGEEEEEEE
NT seq 5886 nt   +upstreamnt  +downstreamnt
atgcctggccagttacctgggaagaccatgggggacgtgaaactgtttgcctcgtcgcac
atgtccaaaacctcccacagtgtggatccctcgagggtcagctctctgcctctcaccgag
gcccctgctttcattctgcctcctcggaacctctgcgtcaaagaaggagccaccgccaag
tttgaagggagggtccggggccacccagagccccaggtgacatggcacagaaatgggcaa
accatcaccaatggcggccgcttcctgctggacggtggggtgcgggggactttcagcctc
gtcatccgtggtgtccgtgaggaggacaagggcaagtacacctgtgaagctagcaacggc
agtggcgcccgccaggtgaccgtggagctgactgtggaaggggatcttatgaagaagcat
ggtcagcccgttctttctaaagcctcaggatttccaggggagactcgtcctagcatctgg
ggtgagtgcccgccaaagtttgccaccaagctgggcagagctgtggtcaaagaagggcag
atggggcgattttcctgcaagatcactggccggcctccaccacaggtcacctggctcaag
ggaaatgtcccgttgcagccaagtgcccgagtgtctatgtcagagaagaatggcatgcag
atcctggaaatccacgaggtcactcaggacgacatgggcacgtacacatgcatggtggtg
aatgggtcagggaaagcctccatgtcagcggagctctccatcccaggtttggacaatgcc
accaggttgtcaagaggaaccaaggaccccagtccagacatcaggaaggaggtgaccaat
ggaatctccaaggacccagagactgtggctgaaagtaagaactgttcaagtccccagaag
agcaacttcttagcccaggccaccaacagtcacctcaagtccctgcagcagccaaagctg
aagccgtgtgaagattcccccagaaaggtcctgcagtcctccgtcctgcagaagacctcc
agcaccattgttctgcaggcctcaaaagtccagccagaagtgagagcagcgggcataggg
gcctccggtcctggggaagagaggaagagtctgactgcccctcggcaagccacaccccct
accagacagtgtggcctgggaggctcagttgggaacaaatttatcacggggaacatcccc
atagagaaccaaagggagtcaagatttcccaagtttgagagtcagccccaaagccaagaa
gtcactgaaggtcaaacagtcaagttcacctgtgaggtttcagggataccaaagcctgaa
gtgggttggttcctggaaggcatccccgtgaggagacaagaaggcatcgttgagatttat
gaagacggtacatcccattacctgtgtctgccgagagccgggacgagagacagcgggaga
tacagctgcacagcatccaatacccttggccaagtgtcctgcagttggacgctccgggtg
gaccggccaagcttgacgcagacagccccttccttctctagtgttctgaaggacagtgtt
gtcattgaaggccaggattttgtgctacggtgctctgtacgggggaccccagcaccccag
gtcacttggctgctcaatgggcagcccatccagtttgctcgatccatctgtgaggctggc
gaggccgagctccacatccaggatgccctgcccgaggaccgtggcacctacacctgcctg
gctgagaatgccttggggcaggtgtcctgcagtgccacggtcacggtccaagaaaagaaa
ggcgaaggagagagggcgcaccgtctgcccccagctcccagcaagctcttcgctcccatc
ttcctgcagggtctctctgacctcaaagtcatggatggaagccaggtcactatgacagtc
caggtgtcaggaaacccacctccagaagtcatatggcttcacgacgggaacgagatccag
gagtcagaggacttccacttcgagcagaaaggtggctggcacagcctatgtatccaggaa
gtgttcccggaggacacgggcacatacacctgtgaggcctggaacagcgctggggaggtc
cgcacccaggccatactcaccgtgcaagagccccatgatggcacccagccctggttcatc
agcaagcctcgttcggtgacagcctccctgggccagagtgtcctcatctcctgcgccata
gctggagacccctttcccactgtgcactggctccgagatggcaaagccctctccagggac
catggccactttgagctgctccagaatgaggacgtgttcaccctggttctaaagaacgtg
cagccctggcatgccggccagtatgagatcctgctcaagaaccgggttggcgagtgcagt
tgccaagtgtcactgatgctgcacaaaggtccttccagagtcccaccaccacgggggcgg
gagcctgccagctgtgagggcctctgtggtggaggagttggtgctcatggtgatgctgac
cgtgatgggaccctgaggccctgctggccagcaagagggcagggttggcctgaggaggaa
gacggagaagacgtgagggggctgttgaagagacgggtggagaccaggctgcacacagaa
gaggccatccgccagcaggaggtggggcagctggattttcgagacctcctgggaaagaag
gtgagcacaaagaccgtatcagaagacgacctgaaggacatcccagccgagcagatggat
ttccgcgccaaccttcagcggcaagtgaagccaaagactgtgtctgaggaagagaggaag
gtgcatagcccccagcaggttgacttccggtctgtcctagccaagaaggggacccctaag
acccctgtccctgagaaggtgccacctcaaaaagctgccaccccagactttcgctcagtg
ctaggtagcaagaagaagtcgcctgcggagaatgggggcaacactgctgaggtcttgaat
gtcaaggctggggaaagccccacgcctgcaggcaatgcacagccagtcggggccctgaaa
cccataggcaacgccaagcctgctgagaccctgaagtccgtgggcaatgccaaaccagca
gagaccctgaagcccgtggggaatgccaagccagcagagaccctgaaacccgtaggtaat
gtcaagcctgccgagaccctgaagcccatagccaacgcacagccttcagggtccccaaaa
cccatagccaacgcacagcctattgagacccagaagtctgtggccaatgccaagtctgcc
gagaccccgaaactagcggggaaagaagaactcaaggaggttaggaatgatgtgaactgt
aagaaagcgcatgtcggagccaccggcaatgaaaaaagacctgagagccaaggctcggcc
ccagttttcaaggaaaagctacaagatgtccatgtggctgagggcgagaagctgctactc
cagtgccaggtgacctctgatcctccggccactgtcacctggacactgaatggaaagaca
ctcaagaccacaaaattcatcatcctcgcccaagaaggctcactcttctccgtctccatc
gagaaggcactgcctgaggacaggggtctatacaagtgtgtagccaagaacagcgctggc
caggcggaatgttcctgccaagtcactgtggacgatgctgggaccagcgagaacaccaag
gccccggagatgaaatcccggagacccaagagctctcttacgcctgtgctaggaacggaa
agtgatgctactgtgaaaaagaaacctgcctccaagacacctacaaaagcagctatgcct
cctcagatcatccagttccctgaggaccagaaggtgcgtgctggagagccagtggagctg
tttgggaaagtgaccggtacccagcccatcacctgcacgtggatgaagttccgaaagcag
atccaggagagcgagaacatcagggtggagaacagtgagagcggcagcaagctcaccatc
ctggctgcacggcaggagcactgtggctgctacacactggtggtggagaacaagctgagc
agcagacaggcccaagtcaacctcacggttgtggataagccagaccccccggctggcaca
ccttgtgcttctgacatacggagttcctcgctcaccctgtcctggtatggctcctcgtat
gatgggggcagtgccgtacagtcctacaatgttgagatctgggacacggaggacaaggtg
tggacagagctagccacgtgccgcagcacctctttcaatgtccaagacctgctgcctgac
cgcgagtataaattccgagtacgtgcagtcaacgtctacggaaccagcgagccgagccag
gagtctgagctcaccgcagtgggagagaagcctgaagagccaaaggatgaagtggaagtg
tccgatgatgacgaaaaggagcctgaggttgattaccggacggtgacggtgaacactgaa
cagaaagtatctgatgtatatgacattgaagagcgactaggatctgggaaatttggacaa
gtcttccgacttgttgaaaagagaactggaaaaatctgggcagggaaatttttcaaggcc
tattccgccaaggagaaagaaaacatccgtcaggagatcagcatcatgaactgtctccac
caccccaagctggtccagtgcgtggatgccttcgaagaaaaggccaacatcgtcatggtt
ctggagattgtgtcagggggtgagctatttgagcgcatcattgatgaggacttcgagcta
acagagcgggagtgcatcaagtacatgaggcagatttcggaaggggtggagtacatccac
aagcagggcatcgtgcatctggacctcaagcctgagaacattatgtgtgtcaacaagaca
ggcaccaggatcaagctcattgacttcggcctggcacgaagactcgagaacgctgggtct
ctgaaggtcctctttgggaccccagagtttgtggctcctgaggtgatcaactatgagccc
atcggctacgccacagacatgtggagcatcggggtcatctgctatattctggtcagcgga
ctttcccccttcatgggtgacaatgataacgaaactttagccaatgtcacttcagctacc
tgggacttcgacgacgaggcgttcgatgagatctcggaagatgcgaaggacttcatcagt
aacttgctaaagaaagatatgaaaaaccgtctggactgcacccagtgccttcagcaccca
tggctgatgaaagacaccaagaacatggaggccaagaagctgtccaaggaccggatgaag
aaatacatggcaagaaggaagtggcagaaaacaggcaatgctgtgagagccattgggaga
ctgtcctctatggcaatgatctcagggctcagtggcaggaaatcttcaacagggtcacca
accagcccgatcaatgcagagaagctagagtctgaagaagatgtctcccaggccttcctc
gaggctgttgctgaggaaaagccccatgtaaagccctacttctctaagaccattcgtgac
ctggaggttgtggagggaagcgctgctagatttgactgcaagatcgaaggatacccagac
cctgaggttgtctggttcaaggatgaccagtcaatcagggagtcccgccacttccagata
gactacgatgaagacgggaactgctcgctaattatcagtgatgtctgtggggatgatgac
gccaagtacacctgcaaggctgtcaacagcctcggagaagccacctgcaccgcggagctc
atcgtggagaccatggaggaaggggaaggggaggaggggggggaggaggaggaggaggag
gagtga

KEGG   Rattus norvegicus (rat): 291926
Entry
291926            CDS       T01003                                 

Gene name
Mylk3
Definition
(RefSeq) myosin light chain kinase 3
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04510  Focal adhesion
rno04611  Platelet activation
rno04810  Regulation of actin cytoskeleton
rno04921  Oxytocin signaling pathway
rno04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    291926 (Mylk3)
   04020 Calcium signaling pathway
    291926 (Mylk3)
   04022 cGMP-PKG signaling pathway
    291926 (Mylk3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    291926 (Mylk3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    291926 (Mylk3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    291926 (Mylk3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    291926 (Mylk3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    291926 (Mylk3)
  09154 Digestive system
   04971 Gastric acid secretion
    291926 (Mylk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    291926 (Mylk3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     291926 (Mylk3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   291926 (Mylk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kinase-like Kdo APH TRPM_tetra
Other DBs
NCBI-GeneID: 291926
NCBI-ProteinID: NP_001104280
RGD: 1305801
Ensembl: ENSRNOG00000017546
UniProt: E9PT87
Position
19
AA seq 786 aa
MSGVSEEDPEGLGPQGLPALGGACLVTVDKKLNVLTEKVDRLLHFQEDVTEKLQCVCQGM
DHLEQGLHRLEASQELGLAGPGSTSPAAAQAAWPEVLELVRAVRQEGAQHGARLEALFKM
VVAVDRAITLVGSTIQNSKVDDFILQGTVPWRKGSLADGPEENKEQAEVAGVKPKHVLNT
GSVQAATSRALWEESQKQDTPVGTVEGLPLIIDTSLKGADLTQAGASLRQGVEALDPGQE
PPPAEAESRLPALASEDTGTTLELSVAIDRISEVLTSLRMSQSAGEGTSSSKPDCSEPGP
QPLGPLTTDSDIHSDEGLPRISVRMREMTTPEELFETQGGSPIGSAEAPGPGTVLEDQIP
KGARPFPPLPKRSCNNGGASAEEATGPGAEPIRGPSLVTRDWRDEPVGTTDLQQGRDPGA
VSPEPGKDHAAQGPGRTEAGRRVSSAAEAAIVVLDDSAAPPAPFEHRVVSIKDTLISTSY
TVSQHEVLGGGRFGQVHRCTERSTGLALAAKIIKVKNIKDREDVKNEINIMNQLSHVNLI
QLYDAFESKNSFTLIMEYVDGGELFDRITDEKYHLTELDVVLFTRQICEGVHYLHQHYIL
HLDLKPENILCVSQTGHQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPT
DMWSVGVITYMLLSGLSPFLGETDAETMNFIVNCSWDFDADTFKGLSEEAKDFVSRLLVK
EKSCRMSATQCLKHEWLNHLIAKASGSNVRLRSQLLLQKYMAQRKWKKHFHVVTAVNRLR
KFPTCP
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgtcaggagtttcagaggaggatccagagggtctgggcccccagggtctgccagcgttg
ggcggagcctgcttagtcaccgtggacaaaaaacttaatgtgctgactgagaaggtcgac
agactcttgcatttccaagaagatgtcacagagaagctacagtgtgtgtgccaaggcatg
gatcacctggaacaaggtctgcatcggctggaggcctcccaggagttgggtctggcaggg
cccggcagcacttccccagccgctgctcaggccgcatggcctgaggtcctggagctggtg
agggccgtgcggcaggagggtgcccagcacggtgccaggctcgaagccctcttcaagatg
gtggtggctgtggacagggctattactttggtagggtccacaatccagaactccaaagtg
gatgatttcatcctgcaagggaccgtgccctggaggaaaggcagtctggctgatggccct
gaggagaacaaggagcaagcagaagtggctggagtgaagccaaagcatgtgctgaataca
ggaagtgtgcaagctgccacttctagggcgctgtgggaagagagccagaagcaggacaca
cccgtggggacagtggaggggctgcctctcatcatcgatacgtcactgaagggagctgac
ctcacccaggctggagcctcactgaggcagggagttgaagctcttgacccaggccaagaa
cccccacccgcagaggcagaatccaggcttcctgcactagccagcgaggacactgggacc
accctggaattgtctgtagcaattgacagaatcagtgaggtcctcactagcctcaggatg
tcccaaagtgctggcgaaggaacctcatccagcaagcctgactgttcagagcctggccct
cagcccctagggccactaactacagacagtgacattcacagtgatgaaggacttcccagg
atctctgtccgtatgcgagagatgactactcctgaggagctgtttgagacccaaggtggc
agccccattggctcggcagaagctccaggccctggaactgtgttagaagaccagatccct
aaaggagccagaccatttccacccctgccaaagaggagctgcaacaatggtggcgcgagt
gcagaggaggcaacagggcctggggctgagcccatcagaggaccaagcttggtcacaagg
gactggagagatgaacctgttgggaccacagacctgcagcaaggcagagacccaggagcg
gtgagccctgaacctgggaaggaccatgcagcccagggcccagggagaaccgaagctgga
aggagggtgtcttctgctgcagaggctgccatcgtagttctagatgacagcgcagcaccc
ccagccccttttgaacaccgggtagtgagcatcaaagacaccctcatctcgacaagttac
acagtgtcccaacacgaagtcttgggagggggccggtttggccaggtgcacaggtgtaca
gagcggtccacaggccttgcactggcagccaagatcatcaaagtgaagaacataaaggac
cgggaggatgtgaagaatgagatcaacatcatgaaccagctcagccacgtaaacttgatc
caactttatgatgcttttgagagcaagaacagcttcaccctgatcatggagtatgtggat
ggaggtgaactcttcgaccggatcacggatgagaagtaccacctgaccgagctggatgtg
gtcttgttcacaaggcagatctgtgagggtgtgcattacctgcaccagcactacattctg
cacctggacctcaagccagagaacatactgtgtgtcagccagactgggcatcaaattaag
attattgactttgggctggctagaagatataaacctcgggagaagctaaaggttaacttt
ggtactccagagttcctggctccagaagttgttaactatgagtttgtctcattcccaaca
gacatgtggagtgtgggagttatcacctacatgctactcagtggtttgtccccatttcta
ggggaaacagatgcagagaccatgaattttattgtgaactgcagctgggatttcgatgct
gataccttcaaagggctgtcagaggaagccaaggactttgtttcacggttgctggtcaaa
gagaagagttgtaggatgagcgccacacagtgcctgaaacatgagtggttaaatcacctg
attgccaaagcctcaggctccaacgttcgcctcagatcccaactactgctgcagaaatat
atggctcagcgtaaatggaagaaacatttccatgtggtgactgcagtcaacaggctaaga
aaatttccaacgtgtccctaa

DBGET integrated database retrieval system