KEGG   Rattus norvegicus (rat): 100911248Help
Entry
100911248         CDS       T01003                                 

Definition
(RefSeq) crk-like protein-like
  KO
K04438  proto-oncogene C-crk
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04015  Rap1 signaling pathway
rno04062  Chemokine signaling pathway
rno04510  Focal adhesion
rno04666  Fc gamma R-mediated phagocytosis
rno04722  Neurotrophin signaling pathway
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno05100  Bacterial invasion of epithelial cells
rno05135  Yersinia infection
rno05163  Human cytomegalovirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05211  Renal cell carcinoma
rno05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100911248
   04010 MAPK signaling pathway
    100911248
   04012 ErbB signaling pathway
    100911248
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100911248
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100911248
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100911248
   04062 Chemokine signaling pathway
    100911248
  09152 Endocrine system
   04910 Insulin signaling pathway
    100911248
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100911248
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100911248
   05206 MicroRNAs in cancer
    100911248
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100911248
   05211 Renal cell carcinoma
    100911248
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100911248
   05100 Bacterial invasion of epithelial cells
    100911248
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100911248
   05163 Human cytomegalovirus infection
    100911248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Motif
Other DBs
NCBI-GeneID: 100911248
NCBI-ProteinID: XP_003751143
RGD: 6493647
Ensembl: ENSRNOG00000001868
UniProt: Q5U2U2
Position
11q23
AA seq 303 aa AA seqDB search
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPNPPMGSVSAPNLST
AEENLEYVRTLYDFPGNDAEDLPFKKGELLVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPTVASTPGAAINPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
DNE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgccaggtttgattcttcagaccgttctgcctggtacatggggccagtgtct
cgccaggaggcgcagacccgtctccagggccagcgccatggcatgttcctagtccgggac
tcatctacctgccctggggactatgtactgtccgtgtccgagaactcgcgtgtctcgcac
tacatcatcaactccctgcccaaccgccgctttaagatcggggaccaggagtttgaccat
ttgccggccttgctggagttctacaagatccactacctggatactaccaccttaatcgaa
ccagcgcccaggtaccccaacccaccaatgggttctgtctcagcacccaacttatctaca
gcagaagaaaatctggaatatgtacggactctgtatgattttcctgggaatgatgctgaa
gacctaccctttaaaaagggtgagcttctagtgataatagaaaagcctgaagaacagtgg
tggagtgcccgcaacaaggacggccgggttgggatgattcctgtcccttacgttgaaaag
cttgtgaggtcctcaccacatggaaagcatggaaataggaattctaacagttatggcatc
ccagaacctgctcacgcatatgctcaacctcagaccacaactcctctacctacagttgcc
agtactcctggggcagcgatcaaccctttgccatccacacagaatggacctgtctttgca
aaagcaatccagaagagagtaccttgtgcttatgacaagactgccttggcattggaggtt
ggtgacattgtgaaagtcacaaggatgaatatcaatggccagtgggaaggcgaggtgaat
gggcgcaaggggcttttccccttcacacatgttaaaatctttgaccctcagaaccccgat
gataacgagtga

DBGET integrated database retrieval system