KEGG   Rattus norvegicus (rat): 100911295
Entry
100911295         CDS       T01003                                 

Definition
(RefSeq) non-histone chromosomal protein HMG-14-like
  KO
K11299  high-mobility group nucleosome-binding domain-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100911295
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    100911295
SSDB
Motif
Pfam: HMG14_17
Other DBs
NCBI-GeneID: 100911295
NCBI-ProteinID: XP_003751077
RGD: 6494054
Ensembl: ENSRNOG00000048226
UniProt: Q5U1W8
Position
11q12
AA seq 96 aa
MPKRKVSADGAAKAEPKRRSARLSAKPAPAKVDAKPKKAAGKDKASDKKAQIKGKRGAKG
KQAEVADQQTTDLPAENGETENQSPASEEEKEAKSD
NT seq 291 nt   +upstreamnt  +downstreamnt
atgcccaagaggaaggttagcgcagatggagcggcgaaggcggagcccaagcgccgctcc
gcgaggctgtcggccaagcccgcccctgccaaggtggacgcgaaaccgaaaaaggccgcg
ggaaaggataaagcatcagacaaaaaagcacagataaaagggaagaggggagcgaagggc
aaacaggctgaagtggctgaccagcaaactacagatctgcctgcagaaaatggagagacg
gaaaaccagagtccagcctctgaggaagagaaagaagcgaagtctgattaa

DBGET integrated database retrieval system