KEGG   Rattus norvegicus (rat): 100911305Help
Entry
100911305         CDS       T01003                                 

Definition
(RefSeq) methionine--tRNA ligase, mitochondrial-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00450  Selenocompound metabolism
rno00970  Aminoacyl-tRNA biosynthesis
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100911305
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100911305
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rno01007]
    100911305
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    100911305
Enzymes [BR:rno01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     100911305
Amino acid related enzymes [BR:rno01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   100911305
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100911305
 Prokaryotic type
   Other AARSs
    100911305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f PP1
Motif
Other DBs
NCBI-GeneID: 100911305
NCBI-ProteinID: XP_003750747
RGD: 6494075
Ensembl: ENSRNOG00000048668
UniProt: D4A9V7
Position
9q31
AA seq 586 aa AA seqDB search
MLRQCALWVLTRTPAGRGCRRYSSCSPSASGDAREARAYFTTPIFYVNAAPHIGHLYSAL
LADALCRHRRLRVPGSGSTRFSTGTDEHGLKIQQAAATAGLAPIELCDRVSAQFLQLFRE
AGISSTDFIRTTEARHRVAVQHFWGVLEARGLLYKGIYEGWYCASDECFLPEAKVTRQVG
PSGDPCPVSLESGHPVSWTKEENYIFKLSQFREPLQRWLRNNPQAITPEPFHQVVLQWLE
EELPDLSVSRRSSHLHWGIPVPGDDSQTIYVWLDALVNYLTVVGYPDADFKSWWPATSHI
IGKDILKFHAIYWPALLLGAGLRPPHRICVHSHWTVSGQKMSKSLGNVVDPRTCLDRYTV
DGFRYFLLRQGVPNWDCDYYDEKVVKLLDSELADALGGLLNRCTAYRINPSGTYPSFCAA
CFPSEPGLMGPSVRVQAEDYALVNAVATLPKLVAGYYNDFQIYKALEAVSSCVRQTNGFV
QRHAPWKLTWESPADAPWLGTVLHVALECLRVFGTLLQPVTPNLADKLLSRLGVSTTERS
LGELYFLPRFYGHPCPFEGRKLGPDTGLLFPRLDQSRTRLVKAHRT
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcagtgcgctctgtgggtgctgacgcgcaccccggccggccgcggctgtcgc
cgctacagttcgtgctcgccgagcgctagtggcgacgctcgggaagcgcgggcctacttc
accacacccatcttctacgtgaacgccgcgccgcacatcgggcacctgtactccgcgctg
ctggccgacgccctgtgccgccaccgtcgtctccgagttcccggctctgggtccacgcgt
ttttctaccggtacggacgagcacggcctgaagatccagcaggcggcagccaccgcgggc
ctggccccgatcgagctgtgcgatcgagtgtctgcccagttcctgcagcttttccgggag
gctggcatctcctccaccgactttatccgcaccacggaggctcggcaccgggtagcggtg
cagcacttctggggtgtgctggaggcccggggtctgctttacaaagggatctatgaaggg
tggtattgcgcctcggatgagtgtttcctgcctgaggccaaggtcactcggcaggtgggt
ccgtccggggatccttgtcctgtctctctcgagagcggacaccctgtctcctggaccaag
gaagaaaattacattttcaagctttctcagttccgagaaccactccagcggtggcttcga
aacaaccctcaggcgatcacaccggaaccgttccaccaggtagttcttcagtggctggag
gaggagctgcctgatttgtcggtttctcggaggagtagccatctgcactggggcattcca
gttcccggggacgactcgcagactatctacgtgtggctggatgccctggtcaactacctc
actgtagttggctacccggatgcagatttcaagtcttggtggccagcaacatctcatatt
atcggtaaggacattctcaaatttcatgctatttattggcctgcccttctcctaggggca
gggttgaggccaccacatcgcatctgtgtccactcgcactggacggtaagtggccaaaaa
atgtccaagagcttgggcaacgtggtggatcccaggacttgccttgatcgctatactgtg
gatggcttccgctactttcttcttcggcagggcgttcccaactgggactgcgactactat
gatgagaaggtggttaaattgctggactctgagctggcagatgccttaggagggctttta
aaccggtgcactgcctacagaataaacccttctgggacctacccatctttctgtgctgcc
tgtttccccagtgagccggggttaatggggccgtcagtccgtgtgcaagcagaagactac
gcacttgtaaatgcagtggccaccttacccaaactggtagcgggctattataacgacttt
cagatctataaggctctggaggcggtatccagttgtgttcggcaaactaatggcttcgtc
caaaggcacgcaccatggaaattgacctgggagagccctgcggatgctccctggctgggt
accgtgcttcacgtggccttggagtgcttgcgagtgtttggaactttgcttcagcctgtt
acaccaaacttagctgataagttgctgtcaagactgggagtctctaccacagagagaagc
cttggagagctctacttcctacctcgattctatggacacccatgcccctttgaagggaga
aaattgggacctgacactgggcttttgtttccgagactggaccaatccaggactcggcta
gtgaaagcccataggacctag

DBGET integrated database retrieval system