KEGG   Rattus norvegicus (rat): 100911365
Entry
100911365         CDS       T01003                                 

Definition
(RefSeq) Parkinson disease 7 domain-containing protein 1-like
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DJ-1_PfpI ThiJ_like
Other DBs
NCBI-GeneID: 100911365
NCBI-ProteinID: XP_003749054
RGD: 6493620
Ensembl: ENSRNOG00000045795
UniProt: D3ZVI9
Position
1q41
AA seq 220 aa
MASERLPSRPACLLVASGASEGVSAQSFVHCFTLASAAFNLQVATPGGKAMDFVDVTENN
ARWVQDFRLKAYASPAKLESIDGARYHALLIPSCPGALTDLASSGSLARILQHFHSESKP
ICAIGHGVAALCCATNEDRSWVFQGYSLTGPSVYELIRAPGFARLSLIVEDFVKDSGAGF
SASEPDAVHVVLDRHLVTGQNANSTVPAVQNLLFLCGGRK
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcgtcggagaggctgccaagcaggcctgcctgtctcctggtggccagcggcgcttcc
gaaggtgtgtcagcccagtccttcgtccactgtttcacactggccagtgctgccttcaac
ctacaggtggccaccccggggggaaaggccatggactttgtggatgtgacagagaacaat
gcacgttgggtacaagacttccgcctcaaggcatatgccagccctgctaaacttgagtcc
attgacggtgcccggtaccatgccctgctgattcccagctgtcctggcgccctgactgac
ctcgccagcagtgggtccctggctcgaatactgcagcacttccactctgagagcaaaccc
atctgtgccattggccatggtgttgctgccctgtgctgtgctaccaatgaagataggtcc
tgggtgttccagggctacagtctgacagggccttctgtgtatgagctcatcagggcacct
ggctttgcccgcctatcattgatcgttgaggactttgtgaaggactctggggctggcttc
agtgccagtgagcccgatgccgtgcatgtggtgctggatcgccatctggtcactggccag
aatgccaactccactgttcccgctgttcagaacctgctcttcctctgcggcggccggaag
taa

DBGET integrated database retrieval system