KEGG   Rattus norvegicus (rat): 100911438
Entry
100911438         CDS       T01003                                 

Definition
(RefSeq) olfactory receptor 143-like
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    100911438
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    100911438
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    100911438
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 100911438
NCBI-ProteinID: XP_006242890
RGD: 6492568
Ensembl: ENSRNOG00000054847
UniProt: M0R9R7
Position
8q21
AA seq 313 aa
MKKIIMENDSFVSEFILMGLTDQPGLQLPLFALFLMNYTATVMGNLSLMSLIFLNSNLHT
PMYFFIFNLSFIDFCYSYVFTPKMLMSFILERNTISFRGCITQLFFFCFFVNSESYVLTA
MAYDRYVAICKPLLYKAIMVPRICCLLIFVSYLIGFVCAMILTGLMFRLKFCNISIINHY
MCDIFPVIRISCSNTYVNELVSSAVVGTGIILCSLLILISYAMILSNILYMSSGKGWSKA
LGTCGSHIITVSFFYGSGLLAYVKPSSAETVGQGKIFSVFYTFLVPMLNPLIYSLQNKDV
KIAVKKTLKRITS
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaagaaaataattatggagaatgactcttttgtgtctgaatttattcttatgggactg
acagaccaacctgggctccagctgcccctatttgctctgtttttaatgaactacacagcc
actgtgatgggaaacttgagcttaatgagtctcattttcttgaactcaaatcttcatacc
ccgatgtacttttttatcttcaatttgtcctttattgacttttgttattcatatgtcttt
actcccaaaatgctgatgagttttattttagagaggaacaccatctccttcagaggatgc
ataactcagctctttttcttctgcttttttgtgaactctgagagttatgtgctgacagct
atggcctatgatcgctatgtggcaatctgtaagcctttactatacaaggctatcatggta
cctaggatctgttgtcttctgatatttgtttcatatttgatagggtttgtttgtgccatg
atcctcacaggcttaatgtttaggctcaaattttgtaatatcagcatcatcaatcactac
atgtgtgacatcttccctgtcattcggatctcctgcagtaacacctatgtcaatgaactt
gtgagctctgctgtggtgggtacaggtatcattttatgtagcctccttatcttaatctct
tatgctatgatcctttccaatatcctttatatgtcttcaggtaagggttggtccaaagcc
ttgggcacttgtggttctcacatcataactgttagtttcttctatggatctgggctgctt
gcttatgtaaagccatcttctgctgagactgtaggccagggaaaaattttttcagtgttt
tatacatttctggtgcccatgctgaatcctctcatttacagtctccagaacaaagatgtc
aaaattgctgtgaagaaaacattgaagagaatcacaagttaa

DBGET integrated database retrieval system