KEGG   Rattus norvegicus (rat): 100911464
Entry
100911464         CDS       T01003                                 

Definition
(RefSeq) glutathione S-transferase P-like
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05215  Prostate cancer
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100911464
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100911464
   00982 Drug metabolism - cytochrome P450
    100911464
   00983 Drug metabolism - other enzymes
    100911464
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100911464
   05204 Chemical carcinogenesis
    100911464
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100911464
   05215 Prostate cancer
    100911464
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100911464
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100911464
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    100911464
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100911464
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   100911464
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N
Other DBs
NCBI-GeneID: 100911464
NCBI-ProteinID: XP_038967329
RGD: 6492721
Position
5
AA seq 249 aa
MGHDGQPPDCPQGMKAITKPHPLQGGKDNGARTACSTAGGDPMPETARMEFSLKHALWKL
LETAGIISQDVETTVALFKGLFRFEVVQGWSGKLHTCLYGQLPKFEDGDLTLYQSSAILR
HVGHSFGLYGKGQREAALVDMVNDGVEDLHYRYVTLIYTIYENGKDDYMKALPGHLKPFE
TLLSQNQEGKAFIVGDQISFANYNLLDLLLVHFPLLAAYVVHLSAQPKIKAFLSSSNDVN
RPINDKGKQ
NT seq 750 nt   +upstreamnt  +downstreamnt
atgggtcatgacggtcagcccccggactgtcctcagggcatgaaagctataaccaagcca
caccctcttcaaggagggaaggataatggagcaagaactgcatgcagcactgcaggagga
gacccgatgccagaaactgctcgaatggaattttcactaaagcatgccctttggaaactt
ctagaaacagctgggattatttcccaagatgtagaaacaacagtggctttgtttaaaggt
ttgttcaggtttgaagtggttcagggatggtcgggaaaattgcacacttgtctgtatggg
cagcttcccaagtttgaggatggagacctcaccctttaccaatctagtgccatcctgagg
cacgtgggccactcttttggactttatgggaaaggccagagggaagccgccctggtggat
atggtgaatgatggggtggaggaccttcactacagatatgtcaccctcatctacaccatc
tatgagaatggtaaggacgactatatgaaggccctgcctgggcatctgaagccttttgag
accctgttgtcccagaaccaggaaggtaaagctttcatcgtgggtgatcagatttccttt
gccaattacaacttgctggacctgctgctggtccacttccccctgctcgctgcctatgtg
gttcacctcagtgcccagcccaagatcaaagcctttctgtcctcctctaacgatgtgaac
cgtcccatcaatgacaagggcaaacagtag

KEGG   Rattus norvegicus (rat): 114846
Entry
114846            CDS       T01003                                 

Gene name
Gsto1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    114846 (Gsto1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    114846 (Gsto1)
   00982 Drug metabolism - cytochrome P450
    114846 (Gsto1)
   00983 Drug metabolism - other enzymes
    114846 (Gsto1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114846 (Gsto1)
   05204 Chemical carcinogenesis
    114846 (Gsto1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    114846 (Gsto1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    114846 (Gsto1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    114846 (Gsto1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    114846 (Gsto1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     114846 (Gsto1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   114846 (Gsto1)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_3 Glutaredoxin GST_C_5
Other DBs
NCBI-GeneID: 114846
NCBI-ProteinID: NP_001007603
RGD: 70952
Ensembl: ENSRNOG00000028746
Vega: OTTRNOG00000000845
UniProt: Q6AXR6
Position
1
AA seq 241 aa
MSGASARSLGKGSAPPGPVPEGQIRVYSMRFCPFAQRTLMVLKAKGIRHEIININLKNKP
EWFFEKNPFGLVPVLENTQGHLITESVITCEYLDEAYPEKKLFPDDPYEKACQKMTFELF
SKVPSLVTSFIRAKRKEDHPGIKEELKKEFSKLEEAMAKKRTAFFGGNSLSMIDYLIWPW
FQRLEALELNECIDHTPKLKLWMATMQEDPVASSHFIDAKTYRDYLSLYLQDSPEACDYG
L
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtccggggcgtccgccaggagcctggggaagggaagcgcgccccctggcccggtcccg
gagggccagatccgagtctacagcatgaggttctgtccctttgctcagaggacgctgatg
gtcctgaaggccaagggaatccggcatgaaatcatcaacatcaacctgaagaataagccc
gagtggttctttgagaagaatccctttgggctggtgccggttctggagaacactcagggt
cacttgatcactgaatctgtcatcacttgcgagtacctggatgaagcatacccggagaag
aagttattcccagatgacccgtacgagaaagcttgccagaagatgacctttgagttattc
tcaaaggtgccgtctctggttacgagttttattagggcgaagagaaaggaagaccatccg
ggcataaaggaagaactgaagaaagagttcagcaagctagaagaggctatggctaaaaag
aggacagccttcttcggtgggaattcgctctcaatgatcgattatcttatttggccgtgg
tttcagcgactggaagcactggagctcaatgagtgtatagaccacaccccaaaactcaag
ctctggatggcaaccatgcaggaagaccccgtggcatcatcccacttcattgatgccaag
acctaccgtgattacttaagtctctacctacaggacagccccgaggcctgtgattatggg
ctctga

KEGG   Rattus norvegicus (rat): 171341
Entry
171341            CDS       T01003                                 

Gene name
Mgst1
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    171341 (Mgst1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    171341 (Mgst1)
   00982 Drug metabolism - cytochrome P450
    171341 (Mgst1)
   00983 Drug metabolism - other enzymes
    171341 (Mgst1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    171341 (Mgst1)
   05204 Chemical carcinogenesis
    171341 (Mgst1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    171341 (Mgst1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    171341 (Mgst1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    171341 (Mgst1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    171341 (Mgst1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     171341 (Mgst1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   171341 (Mgst1)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 171341
NCBI-ProteinID: NP_599176
RGD: 70927
Ensembl: ENSRNOG00000007743
UniProt: P08011 B6DYQ4
Structure
PDB: 
2H8A 5IA9 5I9K

Position
4
AA seq 155 aa
MADLKQLMDNEVLMAFTSYATIILAKMMFLSSATAFQRLTNKVFANPEDCAGFGKGENAK
KFLRTDEKVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTALIHFRIFVGARIYHTIA
YLTPLPQPNRGLAFFVGYGVTLSMAYRLLRSRLYL
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgacctcaagcagctcatggacaacgaggtgttgatggcctttacctcctatgca
acgatcattcttgccaagatgatgttcctgagctccgcgactgcattccagaggctaacc
aacaaggtttttgccaacccggaagactgtgctggcttcggcaagggggagaatgccaag
aagttccttcggactgacgagaaggtggaacgcgtgcgaagagcccacctgaacgacctt
gaaaacatcgttccctttctcggtatcggcctcctgtactccctgagcggaccggatctc
tctacagccctcattcacttcagaatctttgtgggcgctcggatctaccacaccattgct
tacttgactccccttcctcagccaaacaggggcttggcattttttgttggctacggagtt
actttgtcaatggcttacaggctgctcaggagcagactgtacttgtaa

KEGG   Rattus norvegicus (rat): 24421
Entry
24421             CDS       T01003                                 

Gene name
Gsta1
Definition
(RefSeq) glutathione S-transferase alpha-3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    24421 (Gsta1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24421 (Gsta1)
   00982 Drug metabolism - cytochrome P450
    24421 (Gsta1)
   00983 Drug metabolism - other enzymes
    24421 (Gsta1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24421 (Gsta1)
   05204 Chemical carcinogenesis
    24421 (Gsta1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24421 (Gsta1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24421 (Gsta1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    24421 (Gsta1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24421 (Gsta1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     24421 (Gsta1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   24421 (Gsta1)
SSDB
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3
Other DBs
NCBI-GeneID: 24421
NCBI-ProteinID: NP_113697
RGD: 2753
UniProt: P04904 B6DYP8
Position
9
AA seq 221 aa
MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEEQFLKTRDDLARLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIATKYNLYGKDMKERALIDMYAEGVADLDEIVLHYPYIPPGEKEAS
LAKIKDKARNRYFPAFEKVLKSHGQDYLVGNRLSRADVYLVQVLYHVEELDPSALANFPL
LKALRTRVSNLPTVKKFLQPGSQRKPLEDEKCVESAVKIFS
NT seq 666 nt   +upstreamnt  +downstreamnt
atgccggggaagccagtccttcactacttcgatggcagggggagaatggagcccatccgg
tggctcctggctgcagctggagtagagtttgaagaacaatttctgaaaactcgggatgac
ctggccaggctaaggaatgatgggagtttgatgttccagcaagtgcccatggtggagatt
gatgggatgaagctggtgcagaccagagccattctcaactacattgccaccaaatacaac
ctctatgggaaggacatgaaggagagagccctcatcgacatgtatgcagaaggagtggcg
gatctggatgaaatagttctccattacccttacattccccctggggagaaagaggcaagt
cttgccaaaatcaaggacaaagcaaggaaccgttactttcctgcctttgaaaaggtgttg
aagagccatggacaagattatctcgttggcaataggctgagcagggctgatgtttaccta
gttcaagttctctaccatgtggaagagctggaccccagcgctttggccaacttccctctg
ctgaaggccctgagaaccagagtcagcaacctccccacagtgaagaagtttcttcagcct
ggcagccagaggaagccattagaggatgagaaatgtgtagaatctgcagttaagatcttc
agttaa

KEGG   Rattus norvegicus (rat): 24422
Entry
24422             CDS       T01003                                 

Gene name
Gsta2
Definition
(RefSeq) glutathione S-transferase alpha-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    24422 (Gsta2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24422 (Gsta2)
   00982 Drug metabolism - cytochrome P450
    24422 (Gsta2)
   00983 Drug metabolism - other enzymes
    24422 (Gsta2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24422 (Gsta2)
   05204 Chemical carcinogenesis
    24422 (Gsta2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24422 (Gsta2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24422 (Gsta2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    24422 (Gsta2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24422 (Gsta2)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     24422 (Gsta2)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   24422 (Gsta2)
SSDB
Motif
Pfam: GST_N GST_C_3 GST_C GST_N_3 Ank_4
Other DBs
NCBI-GeneID: 24422
NCBI-ProteinID: NP_058709
RGD: 2754
Ensembl: ENSRNOG00000029861
UniProt: P00502 B6DYP7
Structure
PDB: 
1EV4 1EV9

Position
8
AA seq 222 aa
MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEI
DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAK
TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPL
LKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtctgggaagccagtgcttcactacttcaatgcccggggcagaatggagtgcatccgg
tggctcctggctgcagcaggagtggagtttgatgagaagtttatacagagtccagaagac
ttggaaaagctaaagaaagacgggaatttgatgtttgaccaagtgcccatggtggagatt
gacgggatgaagctggcacagaccagagccattctcaactacatcgccaccaaatatgac
ctctatgggaaggacatgaaggagagagccctgattgacatgtacaccgaaggcatttta
gatctgactgaaatgattatgcaattggtaatatgtcccccagaccaaaaagaagccaag
accgccttggcaaaagacaggaccaaaaaccggtacttgcctgcctttgaaaaggtgttg
aagagccatggccaagactaccttgtaggtaacaggctgacccgggtagacatccacctg
ctggaacttctcctctatgttgaagagtttgatgccagccttctgacctctttccctctg
ctgaaggccttcaagagcagaatcagcagcctccccaatgtgaagaagttcctgcagcct
ggcagtcagagaaagcttcccgtggatgcaaaacaaatcgaagaagcaaggaagattttc
aagttttag

KEGG   Rattus norvegicus (rat): 24423
Entry
24423             CDS       T01003                                 

Gene name
Gstm1
Definition
(RefSeq) glutathione S-transferase Mu 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    24423 (Gstm1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24423 (Gstm1)
   00982 Drug metabolism - cytochrome P450
    24423 (Gstm1)
   00983 Drug metabolism - other enzymes
    24423 (Gstm1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24423 (Gstm1)
   05204 Chemical carcinogenesis
    24423 (Gstm1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24423 (Gstm1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24423 (Gstm1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    24423 (Gstm1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24423 (Gstm1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     24423 (Gstm1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   24423 (Gstm1)
SSDB
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_C_2 GST_N_3 GST_N_4
Other DBs
NCBI-GeneID: 24423
NCBI-ProteinID: NP_058710
RGD: 2755
Ensembl: ENSRNOG00000029726
UniProt: P04905
Structure
PDB: 
5FWG 1MTC 3FYG 1GSB 1GSC

Position
2
AA seq 218 aa
MPMILGYWNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDF
EKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPN
LKDFLARFEGLKKISAYMKSSHYLSTPIFSKLAQWSNK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcctatgatactgggatactggaacgtccgcgggctgacacacccgatccgcctgctc
ctggaatacacagactcaagctatgaggagaagagatacgccatgggcgacgctcccgac
tatgacagaagccagtggctgaatgagaagttcaaactgggcctggacttccccaatctg
ccctacttaattgatggatcgcgcaagattacccagagcaatgccataatgcgctacctt
gcccgcaagcaccacctgtgtggagagacagaggaggagcggattcgtgcagacattgtg
gagaaccaggtcatggacaaccgcatgcagctcatcatgctttgttacaaccccgacttt
gagaagcagaagccagagttcttgaagaccatccctgagaagatgaagctctactctgag
ttcctgggcaagcgaccatggtttgcaggggacaaggtcacctatgtggatttccttgct
tatgacattcttgaccagtaccacatttttgagcccaagtgcctggacgccttcccaaac
ctgaaggacttcctggcccgcttcgagggcctgaagaagatctctgcctacatgaagagc
agccactacctctcaacacctatattttcgaagttggcccaatggagtaacaagtag

KEGG   Rattus norvegicus (rat): 24424
Entry
24424             CDS       T01003                                 

Gene name
Gstm2
Definition
(RefSeq) glutathione S-transferase Mu 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    24424 (Gstm2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24424 (Gstm2)
   00982 Drug metabolism - cytochrome P450
    24424 (Gstm2)
   00983 Drug metabolism - other enzymes
    24424 (Gstm2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24424 (Gstm2)
   05204 Chemical carcinogenesis
    24424 (Gstm2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24424 (Gstm2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24424 (Gstm2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    24424 (Gstm2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24424 (Gstm2)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     24424 (Gstm2)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   24424 (Gstm2)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_N_3 GST_C_2 GST_N_2
Other DBs
NCBI-GeneID: 24424
NCBI-ProteinID: NP_803175
RGD: 2756
Ensembl: ENSRNOG00000018937
UniProt: P08010 B6DYQ2
Position
2
AA seq 218 aa
MPMTLGYWDIRGLAHAIRLFLEYTDTSYEDKKYSMGDAPDYDRSQWLSEKFKLGLDFPNL
PYLIDGSHKITQSNAILRYLGRKHNLCGETEEERIRVDVLENQAMDTRLQLAMVCYSPDF
ERKKPEYLEGLPEKMKLYSEFLGKQPWFAGNKITYVDFLVYDVLDQHRIFEPKCLDAFPN
LKDFVARFEGLKKISDYMKSGRFLSKPIFAKMAFWNPK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcctatgacactgggttactgggacatccgtgggctggctcacgccattcgcctgttc
ctggagtatacagacacaagctatgaggacaagaagtacagcatgggggatgctcccgac
tatgacagaagccagtggctgagtgagaagttcaaactgggcctggacttccccaatctg
ccctacttaattgatgggtcacacaagatcacccagagcaatgccatcctgcgctacctt
ggccggaagcacaacctttgtggggagacagaggaggagaggattcgtgtggacgttttg
gagaaccaggctatggacacccgcctacagttggccatggtctgctacagccctgacttt
gagagaaagaagccagagtacttagagggtctccctgagaagatgaagctttactccgaa
ttcctgggcaagcagccatggtttgcagggaacaagattacgtatgtggattttcttgtt
tacgatgtccttgatcaacaccgtatatttgaacccaagtgcctggacgccttcccaaac
ctgaaggacttcgtggctcggtttgagggcctgaagaagatatctgactacatgaagagc
ggccgcttcctctccaagccaatctttgcaaagatggccttttggaacccaaagtag

KEGG   Rattus norvegicus (rat): 24426
Entry
24426             CDS       T01003                                 

Gene name
Gstp1
Definition
(RefSeq) glutathione S-transferase P
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05215  Prostate cancer
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    24426 (Gstp1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24426 (Gstp1)
   00982 Drug metabolism - cytochrome P450
    24426 (Gstp1)
   00983 Drug metabolism - other enzymes
    24426 (Gstp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24426 (Gstp1)
   05204 Chemical carcinogenesis
    24426 (Gstp1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24426 (Gstp1)
   05215 Prostate cancer
    24426 (Gstp1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24426 (Gstp1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    24426 (Gstp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24426 (Gstp1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     24426 (Gstp1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   24426 (Gstp1)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N
Other DBs
NCBI-GeneID: 24426
NCBI-ProteinID: NP_036709
RGD: 2758
Ensembl: ENSRNOG00000018237
UniProt: P04906 B6DYQ7
Position
1
AA seq 210 aa
MPPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGD
LTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYV
KALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAY
VARLSARPKIKAFLSSPDHLNRPINGNGKQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccaccgtacaccattgtgtacttcccagttcgagggcgctgtgaggccacgcgcatg
ctgctggctgaccagggccagagctggaaggaggaggtggttaccatagatgtctggctt
caaggctcgctcaagtccacttgtctgtatgggcagctccccaagtttgaagatggagac
ctcaccctttaccaatctaatgccatcttgaggcacctgggtcgctctttagggctttat
gggaaagaccagaaggaggctgccttggtggatatggtgaatgatggggtggaggacctt
cgatgcaaatatggtaccctcatctacactaactatgagaatggtaaggatgactatgtg
aaggccctgcctgggcatctgaaaccttttgagaccctgctgtcccagaaccagggaggc
aaagctttcattgtgggtaaccagatttcctttgcagattacaacttgctggacctgctg
ctggtccaccaagtcctggcccctggctgcctggacaacttccccctgctctctgcctat
gtggctcgcctcagtgcccgccccaagatcaaggcctttctgtcctcccctgaccatttg
aaccgtcccatcaacggcaatggtaaacagtag

KEGG   Rattus norvegicus (rat): 25260
Entry
25260             CDS       T01003                                 

Gene name
Gstt1
Definition
(RefSeq) glutathione S-transferase theta-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    25260 (Gstt1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    25260 (Gstt1)
   00982 Drug metabolism - cytochrome P450
    25260 (Gstt1)
   00983 Drug metabolism - other enzymes
    25260 (Gstt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25260 (Gstt1)
   05204 Chemical carcinogenesis
    25260 (Gstt1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    25260 (Gstt1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    25260 (Gstt1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    25260 (Gstt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    25260 (Gstt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     25260 (Gstt1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   25260 (Gstt1)
SSDB
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_N_4 GST_C_3
Other DBs
NCBI-GeneID: 25260
NCBI-ProteinID: NP_445745
RGD: 2765
Ensembl: ENSRNOG00000049771
UniProt: Q01579 B6DYQ8
Position
20
AA seq 240 aa
MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDG
GFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMF
PVFLGEQIRPEMLAATLADLDVNVQVLEDQFLQDKDFLVGPHISLADVVAITELMHPVGG
GCPVFEGRPRLAAWYRRVEAAVGKDLFLEAHEVILKVRDCPPADPVIKQKLMPRVLTMIQ
NT seq 723 nt   +upstreamnt  +downstreamnt
atggtcctggaactgtacctggatctgctgtcgcagccctgtcgcgctatttatatcttc
gccaagaagaacaatatcccgttccagatgcatactgtggagctgcgcaagggtgagcac
ctcagcgatgcctttgcccaggtgaaccccatgaagaaggtaccagccatgaaggatggt
ggcttcaccttgtgtgagagtgtggccatcctgctctacctggcgcacaagtataaggtt
cctgaccactggtacccccaagacctgcaggcccgtgctcgtgtggatgagtacctggca
tggcagcatacgacccttcggagaagctgtctccggaccctgtggcataaggtgatgttc
cccgttttcctgggtgagcagatacgcccggagatgctggcagccacattggcagatctg
gatgttaacgtacaggtgctggaagaccagttcctccaggacaaagacttccttgtcgga
ccgcacatctccctggctgacgtggtagctatcacagagctgatgcatcctgtaggtggt
ggctgcccagtctttgaagggcgtcccaggctggctgcatggtacaggagagtggaggca
gctgtggggaaggacctcttcctggaggcccatgaggtcatcctgaaggtgagagactgt
ccacctgctgaccccgtcataaagcaaaagctgatgcccagagtgctgaccatgatccag
tga

KEGG   Rattus norvegicus (rat): 289197
Entry
289197            CDS       T01003                                 

Gene name
Mgst3
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    289197 (Mgst3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    289197 (Mgst3)
   00982 Drug metabolism - cytochrome P450
    289197 (Mgst3)
   00983 Drug metabolism - other enzymes
    289197 (Mgst3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    289197 (Mgst3)
   05204 Chemical carcinogenesis
    289197 (Mgst3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    289197 (Mgst3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    289197 (Mgst3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    289197 (Mgst3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    289197 (Mgst3)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     289197 (Mgst3)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   289197 (Mgst3)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 289197
NCBI-ProteinID: NP_001178523
RGD: 1306373
Ensembl: ENSRNOG00000004245
UniProt: D4ADS4
Position
13
AA seq 152 aa
MAVLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPENGHMFNCIQRA
HQNTLEVYPPFLFFLTVGGVYHPRIASGLGVAWIIGRVLYAYGYYTGDPSKRYRGAVSSL
ALFALMGTTVCSAFQHLGWIKPGLGSGSRSCH
NT seq 459 nt   +upstreamnt  +downstreamnt
atggctgtcctctctaaggaatatggattcgtgcttctcactggtgccgccagctttgtg
atggtgctccacctagccatcaacgtgggcaaagcccgcaagaagtacaaggtagagtac
cctgtcatgtacagcacagatcctgagaatgggcatatgttcaactgcattcagcgcgcc
caccagaacacattggaggtgtaccctcccttcctattcttcctaaccgtgggaggtgtt
taccacccgcgcatagcttctggcctgggcgtggcgtggattattgggcgagttctttac
gcatatggctactacacgggagaccctagcaagcggtatcgaggagctgtgagctctctt
gccctctttgccctgatgggcacaactgtgtgctctgctttccagcatctcggctggatt
aaacccggcctaggcagtgggtccagatcctgccactga

KEGG   Rattus norvegicus (rat): 293656
Entry
293656            CDS       T01003                                 

Gene name
RGD1307603
Definition
(RefSeq) uncharacterized protein LOC293656
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05215  Prostate cancer
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    293656 (RGD1307603)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    293656 (RGD1307603)
   00982 Drug metabolism - cytochrome P450
    293656 (RGD1307603)
   00983 Drug metabolism - other enzymes
    293656 (RGD1307603)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    293656 (RGD1307603)
   05204 Chemical carcinogenesis
    293656 (RGD1307603)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    293656 (RGD1307603)
   05215 Prostate cancer
    293656 (RGD1307603)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    293656 (RGD1307603)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    293656 (RGD1307603)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    293656 (RGD1307603)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     293656 (RGD1307603)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   293656 (RGD1307603)
SSDB
Motif
Pfam: GST_C_3 GST_N GST_N_3 GST_C
Other DBs
NCBI-GeneID: 293656
NCBI-ProteinID: NP_001127980
RGD: 1307603
Ensembl: ENSRNOG00000018287
UniProt: D4A8S2
Position
1
AA seq 174 aa
MPPYTIIYFPSRGHCEVMRMLLADQGQSWKEEVVTLDVWEQGTFKASCLFGQIPKFQDGK
LTLYQSNAILRHLGHSFGLYGKDQQEAALVDMVNDGLEDVFRRIAWHYLHICISFADYRL
LDLLLNLELLFPGYLKDFPLLSAYVARLKARPKLKAFLESPEHVNRLLAACIKM
NT seq 525 nt   +upstreamnt  +downstreamnt
atgccaccttacaccatcatctatttcccctcccgagggcactgtgaggttatgcgcatg
ctgctagccgaccagggccagagttggaaggaggaggtggtgaccttggatgtttgggag
caaggcacattcaaggcttcctgtctgtttgggcagatccccaagttccaggatggaaag
ctcactctgtaccaatcgaatgccatcctacggcacctgggccactccttcgggctctac
ggcaaagaccagcaagaggcagcactggtggacatggtgaacgacggactggaagacgtg
ttcaggcgcattgcatggcactatctccatatctgtatctccttcgccgactaccgccta
ctggatttacttctgaacctagagctcctgttccctggttacttgaaagacttccccctg
ctctccgcctatgtagcgcgtctcaaagcccgacccaagctcaaggccttcctggagtct
cctgagcatgtgaaccgtctccttgctgcttgcataaagatgtga

KEGG   Rattus norvegicus (rat): 29487
Entry
29487             CDS       T01003                                 

Gene name
Gstt2
Definition
(RefSeq) glutathione S-transferase theta-2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    29487 (Gstt2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    29487 (Gstt2)
   00982 Drug metabolism - cytochrome P450
    29487 (Gstt2)
   00983 Drug metabolism - other enzymes
    29487 (Gstt2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    29487 (Gstt2)
   05204 Chemical carcinogenesis
    29487 (Gstt2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    29487 (Gstt2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    29487 (Gstt2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    29487 (Gstt2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29487 (Gstt2)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     29487 (Gstt2)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   29487 (Gstt2)
SSDB
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Oxidored_nitro
Other DBs
NCBI-GeneID: 29487
NCBI-ProteinID: NP_036928
RGD: 69362
Ensembl: ENSRNOG00000052415
UniProt: P30713 B6DYQ9
Position
20
AA seq 244 aa
MGLELYLDLLSQPSRAVYIFAKKNGIPFQLRTVDLLKGQHLSEQFSQVNCLKKVPVLKDG
SFVLTESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLG
PLIGVQVPEEKVERNRNSMVLALQRLEDKFLRDRAFIAGQQVTLADLMSLEELIQPVALG
CNLFEGRPQLTAWRERVEAFLGAELCQEAHNPIMSVLGQAAKKTLPVPPPEAHASMMLRI
ARIP
NT seq 735 nt   +upstreamnt  +downstreamnt
atgggtttggagctctacctggacctgctgtcgcagcccagccgcgcggtctacatcttc
gccaagaagaatggcatcccctttcagttgcgtaccgtggatttactcaaagggcagcac
ttgagcgagcaattctcccaggtgaactgcttaaagaaagtgcctgtcctcaaagacgga
agcttcgtgttgaccgaaagcactgccatcttgatttacctgagttccaagtaccaggtg
gcagaccactggtacccggccgacctacaggcccgtgcccaagtccacgaatacctgggt
tggcatgccgacaacatccgtggcacctttggagtactcctgtggaccaaggtgttgggg
ccactcattggggtccaggttcccgaggaaaaggtggaacggaacagaaatagtatggtc
ttggctctgcaacgtctggaggacaagttcctcagggacagggccttcattgctggccag
caggtgacgctagcggatctcatgtctctagaggagttgatacagccggtggctcttggc
tgtaatctgtttgaggggcggcctcaactgacagcgtggcgagagagggtggaggcgttc
ttgggtgctgagctatgtcaggaggcgcacaaccccatcatgagcgtcctgggacaggca
gccaagaaaacattaccagtaccccctccggaggcccatgccagcatgatgcttcgaatt
gccaggattccctga

KEGG   Rattus norvegicus (rat): 295037
Entry
295037            CDS       T01003                                 

Gene name
Mgst2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    295037 (Mgst2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    295037 (Mgst2)
   00982 Drug metabolism - cytochrome P450
    295037 (Mgst2)
   00983 Drug metabolism - other enzymes
    295037 (Mgst2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    295037 (Mgst2)
   05204 Chemical carcinogenesis
    295037 (Mgst2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    295037 (Mgst2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    295037 (Mgst2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    295037 (Mgst2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    295037 (Mgst2)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     295037 (Mgst2)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   295037 (Mgst2)
SSDB
Motif
Pfam: MAPEG zf_UBZ DUF6442
Other DBs
NCBI-GeneID: 295037
NCBI-ProteinID: NP_001099900
RGD: 1311218
Ensembl: ENSRNOG00000061857
Position
2
AA seq 147 aa
MAGDSSLLAAVSLLSACQQSYFALQVGRVRLKYKIAPPAVTGSLEFERIFRAQQNSLEFY
SVFIISLWMAGWYFNQVFATCLGLLYIYARHKYFWGYAEAAEKRIIGFRLSLGILALLTV
LAVLGVASRFLDEYLDFHVAKKLKRPF
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcgggggattcaagcctgctggctgcagtctcccttctctctgcctgtcagcaaagt
tattttgctttgcaagtcggacgagtaagattaaaatacaagatcgcacctccagcagtc
acgggctctctggagtttgagagaatatttcgcgcacagcaaaactctttggagttttat
tccgtattcatcatatcgctgtggatggctggatggtatttcaatcaagtttttgcaacc
tgtctgggtctcctgtacatatacgcccgtcacaagtatttctggggctatgcagaagcc
gctgaaaaaaggatcattggtttccggctgagcctgggcattttggccttgctgactgtc
ctcgctgtcctgggggtagcaagcagattcctggacgaatacctggactttcatgttgcc
aagaaactgaagcggcccttctaa

KEGG   Rattus norvegicus (rat): 295362
Entry
295362            CDS       T01003                                 

Gene name
Gstm6l
Definition
(RefSeq) glutathione S-transferase, mu 6-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    295362 (Gstm6l)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    295362 (Gstm6l)
   00982 Drug metabolism - cytochrome P450
    295362 (Gstm6l)
   00983 Drug metabolism - other enzymes
    295362 (Gstm6l)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    295362 (Gstm6l)
   05204 Chemical carcinogenesis
    295362 (Gstm6l)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    295362 (Gstm6l)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    295362 (Gstm6l)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    295362 (Gstm6l)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    295362 (Gstm6l)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     295362 (Gstm6l)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   295362 (Gstm6l)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_6 GST_C_2 GST_N_3
Other DBs
NCBI-GeneID: 295362
NCBI-ProteinID: NP_001099934
RGD: 1311731
Ensembl: ENSRNOG00000060939
UniProt: A0A0G2K6L4
Position
2
AA seq 184 aa
MGDAPDYDRSQWLSEKFKLGLDIPNLPYLIDGSHKITQSNAILRYLGRKHNLCGETEEER
LRVDILENQAVDTRRQLSMVCYSPEFEKRKPEYLEGLPDKMKLYSEFLGKQLWFAGNKIT
YVDFLVYDVLDKHRMFELKCLDAFPNLKDFMARFETLEKISAYMKSSRFLSGPVYLKTAL
WGNK
NT seq 555 nt   +upstreamnt  +downstreamnt
atgggggacgctcccgactatgacagaagccagtggctgagtgagaagttcaaactgggc
ctggacattcctaatctgccctacttaatcgatgggtcacacaagatcacccagagcaat
gccatcctgcgctaccttggccggaagcacaacctgtgtggagagacagaagaagagaga
ctccgtgtggacattttggagaaccaggccgtggacactcgtaggcagctttcaatggtc
tgctacagccctgagtttgagaaacggaagccagagtacttagagggtctccctgacaag
atgaagctctactctgagttcctgggcaagcagctatggtttgcagggaacaagattacc
tatgtggatttccttgtttatgatgtcctcgataagcaccgtatgtttgagctcaagtgc
ctggacgcctttccaaatctgaaggacttcatggctcgatttgagacccttgagaagatc
tctgcctacatgaagtccagccgcttcctttcaggccctgtgtatttgaagacagcgctg
tggggtaacaagtag

KEGG   Rattus norvegicus (rat): 297029
Entry
297029            CDS       T01003                                 

Gene name
Gstk1
Definition
(RefSeq) glutathione S-transferase kappa 1
  KO
K13299  glutathione S-transferase kappa 1 [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno01100  Metabolic pathways
rno04146  Peroxisome
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    297029 (Gstk1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    297029 (Gstk1)
   00982 Drug metabolism - cytochrome P450
    297029 (Gstk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    297029 (Gstk1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    297029 (Gstk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     297029 (Gstk1)
SSDB
Motif
Pfam: DSBA DUF4964 Secretin
Other DBs
NCBI-GeneID: 297029
NCBI-ProteinID: NP_852036
RGD: 735188
Ensembl: ENSRNOG00000016484
UniProt: P24473 B6DYQ0
Structure
PDB: 
1R4W

Position
4
AA seq 226 aa
MGPAPRVLELFYDVLSPYSWLGFEVLCRYQHLWNIKLKLRPALLAGIMKDSGNQPPAMVP
HKGQYILKEIPLLKQLFQVPMSVPKDFFGEHVKKGTVNAMRFLTAVSMEQPEMLEKVSRE
LWMRIWSRDEDITESQNILSAAEKAGMATAQAQHLLNKISTELVKSKLRETTGAACKYGA
FGLPTTVAHVDGKTYMLFGSDRMELLAYLLGEKWMGPVPPTLNARL
NT seq 681 nt   +upstreamnt  +downstreamnt
atggggccggcgccgcgcgtcctggaactgttctacgatgtgctgtccccctactcctgg
ctgggctttgaggtcctatgcagataccaacacctctggaatatcaagctgaagttgcgg
cccgctttactcgctgggatcatgaaagacagtggaaaccaaccaccagctatggttccc
cacaaaggccagtacatactcaaagagattcctctcctgaagcagctcttccaggttccc
atgagcgtccccaaggatttctttggtgaacatgttaagaaaggaactgtaaatgccatg
cgcttcctcaccgcggtgagcatggagcaaccagagatgctggagaaggtgtccagagag
ctgtggatgcgcatttggtcccgagatgaagatatcacggagtcccagaacattttgtct
gcagcagagaaggccggaatggccacagcgcaagcccaacaccttctgaataagatctcc
accgaactggtgaagagcaagctcagggagaccactggggcagcctgcaaatatggggcc
tttgggctgcccaccactgttgcccacgtggatggtaaaacctacatgctatttgggtct
gaccgcatggagttgctagcttacctgctaggagagaagtggatgggccctgtgccccca
accctgaatgccagactttaa

KEGG   Rattus norvegicus (rat): 300850
Entry
300850            CDS       T01003                                 

Gene name
Gsta4
Definition
(RefSeq) glutathione S-transferase alpha-4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    300850 (Gsta4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    300850 (Gsta4)
   00982 Drug metabolism - cytochrome P450
    300850 (Gsta4)
   00983 Drug metabolism - other enzymes
    300850 (Gsta4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    300850 (Gsta4)
   05204 Chemical carcinogenesis
    300850 (Gsta4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    300850 (Gsta4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    300850 (Gsta4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    300850 (Gsta4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    300850 (Gsta4)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     300850 (Gsta4)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   300850 (Gsta4)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_3 GST_C_2
Other DBs
NCBI-GeneID: 300850
NCBI-ProteinID: NP_001100310
RGD: 1309970
Ensembl: ENSRNOG00000030449
UniProt: P14942 A9UMW1
Position
8
AA seq 222 aa
MEVKPKLYYFQGRGRMESIRWLLATAGVEFEEEFLETREQYEKLQKDGCLLFGQVPLVEI
DGMLLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIIGAPFKAPQEKEES
LALAVKRAKNRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEAILMVEEVSAPVLSDFPL
LQAFKTRISNIPTIKKFLQPGSQRKPPPDGHYVDVVRTVLKF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggaagtcaaacccaagctctactactttcaaggcaggggaaggatggagtcgatccgc
tggctgctggctacagctggagtggagtttgaagaagaatttcttgagacgagagaacaa
tatgagaagttgcaaaaggatggatgcctgctttttggccaagtcccattggtggaaata
gacgggatgctactgacacagaccagagccatcctcagctacctggccgccaagtacaac
ttgtatgggaaggacctgaaggagagagtcaggattgacatgtatgccgatggcacccag
gacctgatgatgatgattatcggggctccatttaaagcccctcaggaaaaagaagagagc
ctagctttagcagtgaagagggctaaaaaccgttacttcccagtgtttgaaaagatttta
aaagaccatggagaggcatttcttgttggcaaccaactcagttgggcagacatacagcta
ctagaagccattttgatggtggaagaagtcagtgctcctgtgttgtctgacttccctctg
ctgcaggcatttaagacaagaatcagcaacattcctacaattaagaagttcctgcaacct
ggaagtcagaggaagccacctccggatggccactatgttgacgtggtcaggaccgtcctg
aagttctag

KEGG   Rattus norvegicus (rat): 309465
Entry
309465            CDS       T01003                                 

Gene name
Gsto2
Definition
(RefSeq) glutathione S-transferase omega-2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    309465 (Gsto2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    309465 (Gsto2)
   00982 Drug metabolism - cytochrome P450
    309465 (Gsto2)
   00983 Drug metabolism - other enzymes
    309465 (Gsto2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    309465 (Gsto2)
   05204 Chemical carcinogenesis
    309465 (Gsto2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    309465 (Gsto2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    309465 (Gsto2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    309465 (Gsto2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    309465 (Gsto2)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     309465 (Gsto2)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   309465 (Gsto2)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_C
Other DBs
NCBI-GeneID: 309465
NCBI-ProteinID: NP_001012071
RGD: 1310764
Ensembl: ENSRNOG00000012801
Vega: OTTRNOG00000000846
UniProt: Q6AXV9 B6DYQ6
Position
1
AA seq 248 aa
MSGDLTRCLGKGSCPPGPVPEGVIRIYSMRFCPYSHRTRLVLKAKSIRHEIININLKNKP
DWYYTKHPFGQVPVLENSQCQLIYESVIACEYLDDVFPGRKLFPYDPYERARQKMLLELF
CKVPQLSKECLVALRCGRDCTDLKVALRQELCNLEEILEYQNTTFFGGDSISMIDYLVWP
WFERLDVYGLADCVNHTPMLRLWISSMKQDPAVCALHIDKNIFLGFLNLYFQNNPCAFDF
GLCGPIVR
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtctggggatttgacaagatgcttggggaaaggaagctgtcccccagggccggtccct
gagggtgtgatccgaatctacagcatgaggttctgcccctactcgcacaggacacgcctg
gtcctcaaggccaaaagcatcaggcatgaaatcatcaacattaacctgaaaaacaagcct
gattggtactatacaaaacacccttttggccaggttcctgtcctggagaacagccaatgt
cagctgatctatgaatccgtcattgcgtgtgagtacctggatgacgtcttcccaggaagg
aagctgtttccatacgacccatatgaacgagctcgccagaagatgttattggagctattc
tgtaaggtcccacagttaagcaaggaatgtctggtagcgctgagatgtgggagagactgt
acggatctgaaggttgccctgcgtcaggagttgtgcaatctggaagagattcttgaatat
cagaacactaccttcttcggtggagactctatatccatgattgattacctcgtctggccc
tggtttgagcgactggatgtatatggactggctgactgtgtgaatcacaccccaatgctg
cggctctggatatcctccatgaagcaggaccccgcagtgtgcgctctgcacattgataag
aacattttcctgggcttcttgaatctctatttccaaaacaacccttgtgcctttgatttt
gggctgtgtggcccaatcgtacggtaa

KEGG   Rattus norvegicus (rat): 363205
Entry
363205            CDS       T01003                                 

Gene name
RGD1562107
Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    363205 (RGD1562107)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    363205 (RGD1562107)
   00982 Drug metabolism - cytochrome P450
    363205 (RGD1562107)
   00983 Drug metabolism - other enzymes
    363205 (RGD1562107)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    363205 (RGD1562107)
   05204 Chemical carcinogenesis
    363205 (RGD1562107)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    363205 (RGD1562107)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    363205 (RGD1562107)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    363205 (RGD1562107)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    363205 (RGD1562107)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     363205 (RGD1562107)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   363205 (RGD1562107)
SSDB
Motif
Pfam: GST_N GST_N_3
Other DBs
NCBI-GeneID: 363205
NCBI-ProteinID: XP_343546
RGD: 1562107
Ensembl: ENSRNOG00000024755
Position
9
AA seq 152 aa
MAGKPVLHYFNGRGRMESVRWLLAAAGVEFEEELFETREEFEKLLQGGTLMYEQVPMVEI
DGMNLVQTRAILRYVAAKYDLYGRNQEEQAWIDMYVEGLRDLSDMIMYFPLSLPEEKEMN
LEYILQRATTRFFPVYEKVSHDLQLESKREDG
NT seq 459 nt   +upstreamnt  +downstreamnt
atggctgggaagcctgtgcttcattacttcaatggaaggggaagaatggagtcagtccgg
tggctcctggcagcagctggagtagagtttgaggaggaactttttgaaacccgtgaagaa
tttgagaagttactccaaggtggaaccctgatgtatgaacaagtgcccatggtggaaatc
gatggaatgaatttggtgcagaccagagccatcttaagatatgtagctgcaaagtatgac
ttgtacggaaggaaccaggaagagcaagcctggattgatatgtacgtagaaggcttgagg
gacctgagcgacatgataatgtacttcccgctctctctgccggaagagaaggagatgaac
ctggagtacatcctccaaagagccacaacaagattcttcccggtttacgagaaggtgagc
catgaccttcagctcgaatcaaagagagaggacggctaa

KEGG   Rattus norvegicus (rat): 494499
Entry
494499            CDS       T01003                                 

Gene name
Gsta5
Definition
(RefSeq) glutathione S-transferase alpha-2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    494499 (Gsta5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    494499 (Gsta5)
   00982 Drug metabolism - cytochrome P450
    494499 (Gsta5)
   00983 Drug metabolism - other enzymes
    494499 (Gsta5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    494499 (Gsta5)
   05204 Chemical carcinogenesis
    494499 (Gsta5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    494499 (Gsta5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    494499 (Gsta5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    494499 (Gsta5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    494499 (Gsta5)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     494499 (Gsta5)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   494499 (Gsta5)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3
Other DBs
NCBI-GeneID: 494499
NCBI-ProteinID: NP_001010921
RGD: 1593189
Ensembl: ENSRNOG00000000201
UniProt: P04903 Q4FZZ3
Position
8
AA seq 222 aa
MSGKPVLHYFNARGRMECIRWLLAAAGVEFEEKLIQSPEDLEKLKKDGNLMFDQVPMVEI
DGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIIQLVICPPDQREAK
TALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTPFPL
LKAFKSRISSLPNVKKFLQPGSQRKPAMDAKQIEEARKVFKF
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtctgggaagccagtgcttcactacttcaatgcccggggcagaatggagtgcatccgg
tggctcctggctgcagcaggagtggagtttgaagagaagcttatacagagtccagaagac
ttggaaaagctaaagaaagacgggaatttgatgtttgaccaagtgcccatggtggagatt
gacgggatgaagctggcacagaccagagccattctcaactacatcgccaccaaatatgac
ctctatgggaaggacatgaaggagagagccctgattgacatgtattcagagggtatttta
gatctgactgaaatgattatccaattggtaatatgtcccccagaccaaagagaagccaag
accgccttggcaaaagacaggaccaaaaaccggtacttgcctgcctttgaaaaggtgttg
aagagccatggccaagactaccttgtaggcaacaggctgacccgggtagacatccacctg
ctggaacttctcctctatgttgaagagtttgatgccagccttctgacccctttccctctg
ctgaaggccttcaagagcagaatcagcagcctccccaatgtgaagaagttcctgcagcct
ggcagtcagagaaagccagccatggatgcaaaacaaatcgaagaagcaaggaaggttttc
aagttttag

KEGG   Rattus norvegicus (rat): 494500
Entry
494500            CDS       T01003                                 

Gene name
Gsta3
Definition
(RefSeq) glutathione S-transferase alpha-5 isoform 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    494500 (Gsta3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    494500 (Gsta3)
   00982 Drug metabolism - cytochrome P450
    494500 (Gsta3)
   00983 Drug metabolism - other enzymes
    494500 (Gsta3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    494500 (Gsta3)
   05204 Chemical carcinogenesis
    494500 (Gsta3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    494500 (Gsta3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    494500 (Gsta3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    494500 (Gsta3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    494500 (Gsta3)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     494500 (Gsta3)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   494500 (Gsta3)
SSDB
Motif
Pfam: GST_C GST_C_3 GST_N
Other DBs
NCBI-GeneID: 494500
NCBI-ProteinID: NP_001009920
RGD: 1591980
Ensembl: ENSRNOG00000056847
UniProt: P46418
Position
9
AA seq 221 aa
MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEENFLKTRDDLARLRSDGSLMFEQVPMVEI
DGMKLVQTKAILNYIATKYNLYGKDMKERALIDMYAEGVADLELMVLYYPYMPPGEKEAS
LAKIKDKARNRYFPAYEKVLKSHGQDYLVGNKLSRADVSLVELLYHVEEMDPGIVDNFPL
LKALRTRVSNLPTVKKFLQPGSQRKPFDDEKCVESAKKIFS
NT seq 666 nt   +upstreamnt  +downstreamnt
atgccggggaagccagtccttcactacttcgatggcagggggagaatggagcccatccgg
tggctcctggctgcagctggagtagagtttgaagaaaattttctgaaaactcgggatgac
ctggccaggttaagaagtgatgggagtttgatgtttgaacaagtgcccatggtggagatt
gacgggatgaagctggtgcagaccaaagccattctcaactacattgccaccaaatacaac
ctctatgggaaggacatgaaggagagagccctcatcgacatgtatgcagaaggtgtggcc
gatctggagttgatggttctctattacccctacatgccccctggggagaaagaggcgagt
cttgccaagatcaaggacaaagcaaggaaccgttacttccctgcctatgagaaggtgttg
aagagccacggacaagattatctcgttggcaacaagctgagcagggctgatgtttccctg
gttgaacttctctaccatgtggaagagatggacccaggcattgtggacaacttccctctg
ctaaaggccctgagaaccagagtcagcaacctccccacagtgaagaaatttcttcagcct
ggcagccagaggaagccttttgatgatgagaaatgtgtagaatcagcgaagaagatcttc
agttaa

KEGG   Rattus norvegicus (rat): 499422
Entry
499422            CDS       T01003                                 

Gene name
Gstt3
Definition
(RefSeq) glutathione S-transferase, theta 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    499422 (Gstt3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    499422 (Gstt3)
   00982 Drug metabolism - cytochrome P450
    499422 (Gstt3)
   00983 Drug metabolism - other enzymes
    499422 (Gstt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    499422 (Gstt3)
   05204 Chemical carcinogenesis
    499422 (Gstt3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    499422 (Gstt3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    499422 (Gstt3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    499422 (Gstt3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    499422 (Gstt3)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     499422 (Gstt3)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   499422 (Gstt3)
SSDB
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_N_4 Glutaredoxin
Other DBs
NCBI-GeneID: 499422
NCBI-ProteinID: NP_001131115
RGD: 1562732
Ensembl: ENSRNOG00000001242
UniProt: D3Z8I7
Position
20
AA seq 210 aa
MGGKTGIELRSRLRSTEGLRPSRSCSPLQLLLPLSTEAVHPRPISEVCQRLLPTASAMGL
ELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFAQVNPLRKVPALKDGDFV
LAESVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCSRAMWQKVTCQCW
LQNLREPTQTGCVASAGGSRSGGEPLPGGP
NT seq 633 nt   +upstreamnt  +downstreamnt
atgggagggaagactgggatcgagctccgatcgaggctaagaagcactgaaggactaaga
cccagccgttcctgctcgccgttgcagctgcttctgcctctgtccaccgaggcagttcac
ccgaggccgatctccgaggtctgccagcggctacttcccacagcctccgccatgggtctg
gagctctacctggacctgatgtcccagccctgccgtgccgtctacatcttcgccaagaag
aacggcatccccttccagctgcgtaccatcgagctgcttaaaggtcagcattacactgat
gcctttgcccaggtgaaccctttgaggaaggtgccggctttgaaggatggggacttcgtc
ttggcagagagtgtggccatcttgctgtatttgagtagaaagtacaaggcacctgaccac
tggtaccctcaggacctacagacccgagctcgtgtggatgagtacctggcttggcagcac
acagccctgcggagctgttgcagcagggccatgtggcagaaggtgacctgtcagtgctgg
ctgcaaaatcttcgagagccgacccaaactggctgcgtggcgtcagcgggtggaagccgc
agtgggggagagcctcttccaggaggcccatga

KEGG   Rattus norvegicus (rat): 499688
Entry
499688            CDS       T01003                                 

Gene name
Gstm6
Definition
(RefSeq) glutathione S-transferase Mu 6
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    499688 (Gstm6)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    499688 (Gstm6)
   00982 Drug metabolism - cytochrome P450
    499688 (Gstm6)
   00983 Drug metabolism - other enzymes
    499688 (Gstm6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    499688 (Gstm6)
   05204 Chemical carcinogenesis
    499688 (Gstm6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    499688 (Gstm6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    499688 (Gstm6)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    499688 (Gstm6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    499688 (Gstm6)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     499688 (Gstm6)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   499688 (Gstm6)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_C_2 GST_N_3
Other DBs
NCBI-GeneID: 499688
NCBI-ProteinID: NP_001102662
RGD: 1563391
Ensembl: ENSRNOG00000019017
UniProt: B0BN47
Position
2
AA seq 218 aa
MPVTLGYWDIRGLGHAIRLLLEYTETSYEEKRYAMGDAPDYDRSQWLDDKFKLDLDFPNL
PYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDILEKQVMDTRIQMGTLCYSPDF
EKRKPEFLKGLPDQLKLYSEFLGKQPWFAGDKITFADFLVYDVLDQHRMFEPKCLDAFPN
LMDFVVHFEGLKKISAYMKTSRFLPSPVYLKQATWGNK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcccgtgactcttggttattgggatatccgcggattgggtcacgccatccggctgctc
ctggaatacacagaaacaagctatgaggagaagagatacgccatgggcgacgctcccgac
tatgacagaagccagtggctggatgacaaattcaagctggatctggacttccccaatctg
ccctacttaattgatgggtcacacaaggtcacccagagcaatgccatcctgcgctacctt
ggccggaagcacaacctgtgtggggagacagaggaggagaggattcgtgtggacattttg
gagaaacaggtcatggacacccgcattcagatgggcacactctgctacagccctgacttc
gagaaacggaagcctgagttcttgaagggcctcccagatcagctgaagctctactccgag
ttcctggggaagcagccatggtttgcaggggacaagatcacctttgcagatttccttgtc
tatgatgtccttgaccagcaccgaatgtttgaacccaagtgcctggacgccttcccaaac
ctgatggacttcgtggtccactttgagggcctgaagaagatctctgcctatatgaagacc
agccgcttccttccaagtcctgtgtacttaaaacaggccacgtggggcaacaagtag

KEGG   Rattus norvegicus (rat): 499689
Entry
499689            CDS       T01003                                 

Gene name
Gstm4
Definition
(RefSeq) glutathione S-transferase Mu 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    499689 (Gstm4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    499689 (Gstm4)
   00982 Drug metabolism - cytochrome P450
    499689 (Gstm4)
   00983 Drug metabolism - other enzymes
    499689 (Gstm4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    499689 (Gstm4)
   05204 Chemical carcinogenesis
    499689 (Gstm4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    499689 (Gstm4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    499689 (Gstm4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    499689 (Gstm4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    499689 (Gstm4)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     499689 (Gstm4)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   499689 (Gstm4)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_N_3 GST_C_2 Bromo_TP
Other DBs
NCBI-GeneID: 499689
NCBI-ProteinID: NP_001019475
RGD: 1565825
Ensembl: ENSRNOG00000019221
UniProt: Q5BK56
Position
2
AA seq 218 aa
MPMTLGYWDIRGLAHAIRLLLEYTDSSYEEKRYTMGDAPDYDRSQWLSEKFKLGLDFPNL
PYLIDGSHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDF
ENLKAEYLEQLPGMMELFSQFLGKQTWFVGEKITFVDFLAYDILDLHLIFEPKCLDAFPN
LKDFVARFEGLKKISVYMKTSRFLRTPLYTRVATWGNK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcctatgacactgggttactgggacatccgtgggctggctcatgctattcgattactc
ctggaatacacagactcaagctatgaggagaagagatacaccatgggcgacgctcctgac
tatgacagaagccagtggctgagtgagaagttcaaactgggcctggacttccccaatctg
ccctacttaatcgatgggtcacacaagatcacccagagcaatgccatcctgcgctatatt
gcccgaaagcacaacctgtgtggggagacagaagaagagaagattcgtgtggacattttg
gagaaccaggctatggatgtctccaatcagctggctagagtctgttacagcccagacttt
gagaacctgaaggcggaatatttggagcagctccctgggatgatggagctcttctcacag
ttcctggggaagcagacgtggttcgttggtgaaaagattacttttgtagatttccttgct
tatgatatcctggacctgcaccttatattcgaacccaagtgcctggatgccttcccaaac
ctgaaggactttgtggcccgcttcgagggactgaagaagatctctgtttacatgaagacc
agccgcttcctccggacacccctatatacaagggtggctacttggggcaataagtag

KEGG   Rattus norvegicus (rat): 501110
Entry
501110            CDS       T01003                                 

Gene name
Gsta6
Definition
(RefSeq) glutathione S-transferase A6
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    501110 (Gsta6)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    501110 (Gsta6)
   00982 Drug metabolism - cytochrome P450
    501110 (Gsta6)
   00983 Drug metabolism - other enzymes
    501110 (Gsta6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    501110 (Gsta6)
   05204 Chemical carcinogenesis
    501110 (Gsta6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    501110 (Gsta6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    501110 (Gsta6)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    501110 (Gsta6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    501110 (Gsta6)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     501110 (Gsta6)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   501110 (Gsta6)
SSDB
Motif
Pfam: GST_C_3 GST_N GST_C GST_N_3
Other DBs
NCBI-GeneID: 501110
NCBI-ProteinID: NP_001019532
RGD: 1565402
Ensembl: ENSRNOG00000033402
UniProt: Q6AXY0
Position
9
AA seq 222 aa
MAEKPLFHYDEARGRMESVRWLLAAAGVEYEEKFIHTNEDLEKLRSDGVLMFQQVPMVEV
DGMKLVQTRAIMNYFSSKYNLYGKDMKERALIDMYSEGLADLNEMFILYPFDPPGVKEAN
IALMKEKATNRYFPAFEKVFESHGQDYLVGNKLSKADVHLVEMIYNMEELDTNILANFPL
LQALKTRISDMPTIKKFLQPGSQRQPPVDEKSIQKTRKIFKF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggcagagaagcctttatttcattatgatgaggcccggggtagaatggagtctgtgcgg
tggctattggctgcagctggagtagagtatgaagagaagtttatacacactaatgaagac
ttggagaagttaagaagtgatggagttctgatgttccagcaagtgcccatggtggaggtt
gatgggatgaagctggtgcagaccagagccattatgaactatttttccagcaaatacaat
ctctatgggaaggacatgaaggagagagccctcatcgatatgtattcggaagggttggca
gatttgaatgagatgtttattctctacccatttgacccacctggagtcaaagaagcaaat
atcgccctgatgaaagagaaagcaacaaaccgttactttcctgcctttgaaaaggtgttt
gagagtcatggacaggactacctcgttgggaacaagctaagcaaggctgatgttcacctg
gttgaaatgatctacaatatggaagaactagataccaacattttagccaactttcctcta
ctgcaggctctgaaaacccgaatcagcgacatgcccaccataaagaagtttctgcagcct
ggcagccaaaggcagcctcctgttgatgagaaaagtatacaaaagacaaggaagattttc
aagttttaa

KEGG   Rattus norvegicus (rat): 57298
Entry
57298             CDS       T01003                                 

Gene name
Gstm3l
Definition
(RefSeq) glutathione S-transferase Mu 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    57298 (Gstm3l)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    57298 (Gstm3l)
   00982 Drug metabolism - cytochrome P450
    57298 (Gstm3l)
   00983 Drug metabolism - other enzymes
    57298 (Gstm3l)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    57298 (Gstm3l)
   05204 Chemical carcinogenesis
    57298 (Gstm3l)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    57298 (Gstm3l)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    57298 (Gstm3l)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    57298 (Gstm3l)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    57298 (Gstm3l)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     57298 (Gstm3l)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   57298 (Gstm3l)
SSDB
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_C_2 GST_N_3
Other DBs
NCBI-GeneID: 57298
NCBI-ProteinID: NP_065415
RGD: 620381
Ensembl: ENSRNOG00000019058
UniProt: Q9WU21
Position
2
AA seq 218 aa
MAMILGYWNVRGLTHPIRLLLEYTDSNYEEKRYVMGDAPNFDRSQWLSEKFNLGLDIPNL
PYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDTLENQVMDTRIHLMIVCCSPDF
EKQKPEFLKSIPEKMKIYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPECLDAFPN
LKDFLARFEGLKKISAYMKSSSFLPRPVFTKIPQWGTD
NT seq 657 nt   +upstreamnt  +downstreamnt
atggctatgatactgggatattggaacgttcgcggacttactcaccccatccgcctgctc
ctggaatacacagattcaaactatgaggagaagagatacgtcatgggggatgcccccaac
tttgacagaagccagtggctgagtgagaaattcaatcttggcctggacattcccaatttg
ccctacttaattgatgggtcacacaaggtcacccagagcaatgccatcctgcgctacctt
ggccggaagcacaacctgtgtggggagacagaggaggagaggattcgtgtggacactttg
gagaaccaggtcatggacacccgcatacatctcatgatagtttgctgcagtcctgacttt
gagaagcagaagccagagttcttgaagtccatcccggagaagatgaaaatctattcagag
ttcctgggcaagcgaccatggtttgcaggggacaaggtcacctatgtggatttccttgct
tatgacattcttgaccagtaccgtatgtttgagcccgagtgcctggacgccttcccaaac
ctgaaggacttcctggcccgcttcgagggcctgaagaagatctctgcttacatgaagagt
agcagctttctcccaagacctgtgtttactaagataccgcagtggggcactgattag

KEGG   Rattus norvegicus (rat): 58962
Entry
58962             CDS       T01003                                 

Gene name
Hpgds
Definition
(RefSeq) hematopoietic prostaglandin D synthase
  KO
K04097  prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00590  Arachidonic acid metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    58962 (Hpgds)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    58962 (Hpgds)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    58962 (Hpgds)
   00982 Drug metabolism - cytochrome P450
    58962 (Hpgds)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    58962 (Hpgds)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     58962 (Hpgds)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     58962 (Hpgds)
SSDB
Motif
Pfam: GST_C_3 GST_N GST_N_3 GST_C GST_C_6 GST_N_2 GST_N_4
Other DBs
NCBI-GeneID: 58962
NCBI-ProteinID: NP_113832
RGD: 69251
Ensembl: ENSRNOG00000006583
UniProt: O35543
Structure
PDB: 
5Y9Z 6N69 1PD2

Position
4
AA seq 199 aa
MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLT
LHQSLAIARYLTKNTDLAGKTELEQCQVDAVVDTLDDFMSLFPWAEENQDLKERTFNDLL
TRQAPHLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPDLLGIYPRLVSLRNK
VQAIPAISAWILKRPQTKL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgcccaactacaaactgctttattttaatatgaggggaagagcagaaattattcgttat
atatttgcttatttggacatcaagtacgaagatcacagaatagaacaagctgactggcct
aaaatcaaaccaactcttccatttggcaaaatccctgttttggaggtggaaggacttaca
cttcaccagagcctcgcaatagcaagatatttgaccaaaaacacagatttggctgggaag
acagagctggagcagtgtcaagtggatgcagtggtggataccctggacgatttcatgtca
ctctttccatgggcagaggaaaatcaagatctaaaagagcggacgttcaatgacttgctc
acacgtcaagcacctcatcttctgaaagatttggacacatacttaggagacaaagagtgg
tttattggcaattatgtaacttgggcagatttctattgggatatctgcagcaccacactt
ttggtcttaaagcccgacctgttgggcatctaccccagactggtgtcactacggaacaaa
gtccaagctattcctgctatttctgcctggatcctaaagaggccacagacaaaactctaa

KEGG   Rattus norvegicus (rat): 64352
Entry
64352             CDS       T01003                                 

Gene name
Gstm5
Definition
(RefSeq) glutathione S-transferase Mu 5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    64352 (Gstm5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    64352 (Gstm5)
   00982 Drug metabolism - cytochrome P450
    64352 (Gstm5)
   00983 Drug metabolism - other enzymes
    64352 (Gstm5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64352 (Gstm5)
   05204 Chemical carcinogenesis
    64352 (Gstm5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    64352 (Gstm5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    64352 (Gstm5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    64352 (Gstm5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    64352 (Gstm5)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     64352 (Gstm5)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   64352 (Gstm5)
SSDB
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3 GST_C_6
Other DBs
NCBI-GeneID: 64352
NCBI-ProteinID: NP_742035
RGD: 61964
Ensembl: ENSRNOG00000058357
UniProt: Q9Z1B2
Position
2
AA seq 225 aa
MSCSKSMVLGYWDIRGLAHAIRMLLEFTDTSYEEKQYTCGEAPDYDRSQWLDVKFKLDLD
FPNLPYLMDGKNKITQSNAILRYIARKHNMCGDTEEEKIRVDIMENQIMDFRMQLVRLCY
NSNHESLKPQYLEQLPAQLKQFSLFLGKFTWFAGEKLTFVDFLTYDVLDQNRMFEPKCLD
EFPNLKAFMCRFEALEKIAAFLQSDRCFKMPINNKMAKWGNKSIC
NT seq 678 nt   +upstreamnt  +downstreamnt
atgtcgtgctccaagtctatggttctgggttactgggatatccgcgggctggctcatgcc
atccgtatgctcctggagtttactgataccagctatgaagagaaacagtacacgtgtggg
gaagctcctgactatgatagaagccaatggctggacgtgaaattcaagctagatctggat
tttcctaacctgccctaccttatggacgggaagaacaagatcacccagagtaacgccatc
ttgcggtacatcgcacgcaagcacaacatgtgtggtgacaccgaagaagaaaagattcga
gtggacatcatggagaaccagataatggacttccgcatgcagctggttcggctctgctac
aattctaaccacgaaagcctgaagcctcagtatttggaacaactgcctgcacagctgaaa
cagttctcgttgttcctggggaaattcacatggtttgcaggagaaaagctgaccttcgtg
gattttctcacttatgacgtcttggaccagaatcgtatgtttgagcccaagtgcctggat
gagttcccaaatctgaaggctttcatgtgccgttttgaggctttggagaagattgctgca
ttcctgcagtctgaccgctgcttcaagatgccaatcaacaacaagatggccaagtggggt
aacaagagcatatgctga

KEGG   Rattus norvegicus (rat): 686922
Entry
686922            CDS       T01003                                 

Gene name
Gstt4
Definition
(RefSeq) glutathione S-transferase theta-4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    686922 (Gstt4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    686922 (Gstt4)
   00982 Drug metabolism - cytochrome P450
    686922 (Gstt4)
   00983 Drug metabolism - other enzymes
    686922 (Gstt4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    686922 (Gstt4)
   05204 Chemical carcinogenesis
    686922 (Gstt4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    686922 (Gstt4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    686922 (Gstt4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    686922 (Gstt4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    686922 (Gstt4)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     686922 (Gstt4)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   686922 (Gstt4)
SSDB
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C Glutaredoxin GST_C_3 DUF6279 GST_C_2
Other DBs
NCBI-GeneID: 686922
NCBI-ProteinID: NP_001103145
RGD: 1591294
Ensembl: ENSRNOG00000038300
UniProt: Q4V8E6
Position
20
AA seq 240 aa
MGLELYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKVPSLRDG
KFILSESVAILCYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLII
PMITGEEVPTERLDKTLDEVNKNIKQFEEKFLQDKLFITGDHISLADLVALVEMMQPMGT
NHNVFISSKLAEWRMRVELAIGSGLFWEAHDRLVKLPSWDCSTLDPSIKMKICEFLQKYK
NT seq 723 nt   +upstreamnt  +downstreamnt
atgggcctggagctctacatggacttgctgtcagcaccttgccgcgccgtctacatcttt
gccaggaagaatggcatcccctttgacttccagtttgtggatctattaaaaggtcaccat
catagcaaggaatacatcgaaatcaaccccttgaggaaggttcccagcctcagagatggc
aagttcatcttatctgaaagcgtggctatcctctgctacctatgccgaaagtacagcgcg
ccttctcactggtatccgccagacctgcacatgcgtgcccgtgtggacgagttcatggcg
tggcagcatacagctattcaggtgcccatgagtaagatactgtggatcaagttgataatt
ccaatgatcacgggtgaggaggttcctaccgagaggttagacaagacactggatgaggtg
aacaagaacataaaacaatttgaggagaagtttctgcaggacaagttgttcatcactggg
gaccatatctcactggccgacttggtggcactggtggagatgatgcagccaatgggaact
aaccacaatgtcttcatcagctccaagcttgcagaatggagaatgcgggtggagttagcc
atcggttctggcctcttctgggaggctcatgacagactggtgaagttgccaagctgggac
tgttcgacactggacccttcgatcaagatgaagatctgtgagtttctgcagaagtataag
tga

KEGG   Rattus norvegicus (rat): 81869
Entry
81869             CDS       T01003                                 

Gene name
Gstm7
Definition
(RefSeq) glutathione S-transferase Mu 7
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    81869 (Gstm7)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    81869 (Gstm7)
   00982 Drug metabolism - cytochrome P450
    81869 (Gstm7)
   00983 Drug metabolism - other enzymes
    81869 (Gstm7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81869 (Gstm7)
   05204 Chemical carcinogenesis
    81869 (Gstm7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    81869 (Gstm7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    81869 (Gstm7)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    81869 (Gstm7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    81869 (Gstm7)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     81869 (Gstm7)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   81869 (Gstm7)
SSDB
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_N_3 GST_C_2 Bromo_TP GST_N_2
Other DBs
NCBI-GeneID: 81869
NCBI-ProteinID: NP_112416
RGD: 621287
Ensembl: ENSRNOG00000018937
UniProt: P08009
Position
2
AA seq 218 aa
MPMTLGYWDIRGLAHAIRLLLEYTDSSYEEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNL
PYLIDGSHKITQSNAILRYLGRKHNLCGETEEERIRVDILENQLMDNRMVLARLCYNPDF
EKLKPGYLEQLPGMMRLYSEFLGKRPWFAGDKITFVDFIAYDVLERNQVFEATCLDAFPN
LKDFIARFEGLKKISDYMKSSRFLPRPLFTKMAIWGSK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcccatgacactgggttactgggacatccgtgggctagcgcatgccatccgcctgctc
ctggaatacacagactcgagctatgaggagaagagatacaccatgggagacgctcccgac
tttgacagaagccagtggctgaatgagaagttcaaactgggcctggacttccccaatctg
ccctacttaattgatgggtcacacaagatcacccagagcaacgccatcctgcgctatctt
ggccgcaagcacaacctgtgtggggagacagaagaggagaggattcgtgtggacattctg
gagaatcagctcatggacaaccgcatggtgctggcgagactttgctataaccctgacttt
gagaagctgaagccagggtacctggagcaactgcctggaatgatgcggctttactccgag
ttcctgggcaagcggccatggtttgcaggggacaagatcacctttgtggatttcattgct
tacgatgttcttgagaggaaccaagtgtttgaggccacgtgcctggacgcgttcccaaac
ctgaaggatttcatagcgcgctttgagggcctgaagaagatctccgactacatgaagtcc
agccgcttcctcccaagacctctgttcacaaagatggctatttggggcagcaagtag

DBGET integrated database retrieval system