KEGG   Rattus norvegicus (rat): 100911483
Entry
100911483         CDS       T01003                                 

Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-like
  KO
K11353  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 13
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100911483
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100911483
  09159 Environmental adaptation
   04714 Thermogenesis
    100911483
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100911483
   05012 Parkinson disease
    100911483
   05014 Amyotrophic lateral sclerosis
    100911483
   05016 Huntington disease
    100911483
   05020 Prion disease
    100911483
   05022 Pathways of neurodegeneration - multiple diseases
    100911483
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100911483
SSDB
Motif
Pfam: GRIM-19 Planc_extracel
Other DBs
NCBI-GeneID: 100911483
NCBI-ProteinID: NP_001264151
RGD: 6492821
Ensembl: ENSRNOG00000020602
UniProt: D3ZE15
Position
16p14
AA seq 144 aa
MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMFALGIGALIFGYWRIMRWNRERRRL
LIEDLEARIALMPLLQAEKDRRTLQILRENLEEEAIIMKDVPNWKVGESMFHTTRWVPPL
IGELYGLRTKEEMENANFGFTGYT
NT seq 435 nt   +upstreamnt  +downstreamnt
atggcggcgtcgaaggtgaagcaggacatgcccccaccagggggctacggccccatcgac
tacaagcggaacctgccccgccggggactgtcgggatacagcatgtttgctttgggcatc
ggggccttgatctttggctactggagaataatgaggtggaaccgggagcgtaggcgcctg
ctgatcgaggacttggaggccaggatcgccctcatgccactcctccaggcagagaaggac
cgcaggaccctgcagattcttcgggagaacctggaggaggaggctatcatcatgaaagat
gtgcccaactggaaggtgggggagtctatgttccataccacacgatgggtgccacccctc
atcggcgagctttatgggttacgcaccaaggaggagatggagaacgccaacttcggcttc
accgggtacacttag

DBGET integrated database retrieval system