KEGG   Rattus norvegicus (rat): 100911485Help
Entry
100911485         CDS       T01003                                 

Definition
(RefSeq) mitofusin-2-like
  KO
K06030  mitofusin 2 [EC:3.6.5.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04137  Mitophagy - animal
rno04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100911485
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100911485
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    100911485
   03029 Mitochondrial biogenesis [BR:rno03029]
    100911485
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     100911485
Membrane trafficking [BR:rno04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    100911485
  Other autophagy associated proteins
   ER-mitochondria tethering complex
    100911485
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100911485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fzo_mitofusin Dynamin_N MMR_HSR1 Synaptobrevin
Motif
Other DBs
NCBI-GeneID: 100911485
NCBI-ProteinID: XP_003750134
RGD: 6492845
Ensembl: ENSRNOG00000046447
UniProt: Q6IRL2
Position
5q36
AA seq 757 aa AA seqDB search
MSLLFSRCNSIVTVKKDKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESAGFLEDT
HRNTELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDK
VLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSLVS
VMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQF
FHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDR
IFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSAVKTKFEQ
HTVRAKQIAEAVRLIMDSLHIAAQEQRVYCLEMREERQDRLRFIDKQLELLAQDYKLRIK
QMTEEVERQVSTAMAEEIRRLSVLVDEYQMDFHPSPVVLKVYKNELHRHIEEGLGRNMSD
RCSTAIASSLQTMQQDMIDGLKPLLPVSVRNQIDMLVPRQCFSLSYDLNCDKLCADFQED
IEFHFSLGWTMLVNRFLGPKNSRRALLGYNDQVQRPLPLTPANPSMPPLPQGSLTQEELM
VSMVTGLASLTSRTSMGILVVGGVVWKAVGWRLIALSFGLYGLLYVYERLTWTTRAKERA
FKRQFVEYASEKLQLIISYTGSNCSHQVQQELSGTFAHLCQQVDITRDNLEQEIAAMNKK
VEALDSLQSKAKLLRNKAGWLDSELNMFIHQYLQPSR
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgctcttttctcgatgcaactccatcgtcaccgtcaagaaggataagcgacac
atggctgaggtgaatgcttcccctctcaagcactttgtcactgccaagaaaaagatcaat
ggcatctttgagcagctgggggcctacatccaagagagtgccggcttccttgaagacacc
cacaggaatacagaactggacccagttactacagaagagcaggtcctggatgtcaaaggg
tacctgtccaaggtcaggggaatcagcgaggtgctggccaggcggcacatgaaggtggct
ttttttggccggacgagcaatgggaagagcaccgtgatcaatgccatgctttgggacaaa
gttctgccatctgggattggccacaccaccaattgcttcctgcgggttgggggcacggat
ggccacgaggccttcctcctcacggagggctcagaagagaagaagagtgtcaagaccgtg
aaccagctagcccatgccctccatcaggatgagcagctgcatgcaggcagcctggtgagt
gtgatgtggcccaactccaagtgtccacttctgaaggatgacctcgtgctgatggacagc
cctgggatcgatgtcaccacggagctggacagctggattgataagttttgcctggatgct
gatgtgtttgtactggtggccaactcagagtccacgctgatgcagacggagaagcagttc
ttccacaaagtgagtgagcgtctctcccggcccaacatcttcatcctgaacaaccgctgg
gatgcgtctgcctcggagcctgagtacatggaggaggtgcggcggcagcacatggaacgc
tgcaccagctttctggtggatgagctaggcgtggtggatcgagctcaggccggggaccgg
atcttctttgtgtctgccaaggaggtgctcagtgccagggtccagaaagcccagggcatg
ccagaaggaggtggcgctcttgcagaaggttttcaagtgaggatgtttgagtttcagaat
ttcgagaggcgatttgaggagtgcatttcccagtctgcagtaaagaccaaatttgagcag
cacacagtccgggccaagcagattgcagaggccgtccgtctcatcatggattccctgcac
attgcggctcaggagcagcgggtttattgtcttgaaatgcgggaagagcggcaagaccgg
ctgagattcattgacaagcagctggagctcctggctcaagactataagctacggattaag
cagatgacagaggaagtggaaaggcaggtgtccacagccatggctgaagagatcaggcgc
ctctctgtgctggttgacgagtaccagatggactttcacccatccccagttgtcctcaag
gtttataagaatgaactgcaccgccatatagaggaaggcctgggacgaaacatgtctgac
cgctgctccacagccattgccagttcactgcagactatgcagcaagacatgatagacggc
ttgaagccccttcttcctgtgtctgtgcggaatcagatagacatgctggtccctcgacag
tgtttctccctcagctatgacctgaactgtgacaagctgtgcgctgactttcaggaggac
atcgaattccatttctcccttggatggactatgctagtgaataggttcctgggccctaag
aatagccggcgggccttgctgggctacaatgatcaggttcagcgtcctctccctctgaca
cctgccaaccccagcatgccacccttgccacagggctccctcacccaggaggagctcatg
gtctccatggttactggcctggcctctctgacttccaggacctctatgggcattctcgtg
gtcggaggagtggtgtggaaggcagtgggctggagactcatcgccctctcctttggactg
tatggcctcctgtacgtgtatgagcggctgacctggaccaccagagccaaggagagggcc
ttcaagcgccagtttgtggagtatgccagtgagaagctgcagctcattatcagttatacc
ggctctaactgcagccaccaagttcagcaagaattgtctgggacatttgctcatctgtgc
cagcaagttgacatcacccgggataatctggagcaggaaattgctgccatgaacaagaaa
gttgaggctctggattcacttcagagcaaagccaaattgctcaggaataaagctggctgg
ttggacagcgaactcaacatgttcatacaccagtacctgcagcccagcagatag

DBGET integrated database retrieval system