KEGG   Rattus norvegicus (rat): 100911519
Entry
100911519         CDS       T01003                                 

Definition
(RefSeq) p53-induced protein with a death domain-like
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04115  p53 signaling pathway
rno04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100911519
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100911519
   04115 p53 signaling pathway
    100911519
SSDB
Motif
Pfam: LRR_8 Peptidase_S68 ZU5 LRR_4 Death
Other DBs
NCBI-GeneID: 100911519
NCBI-ProteinID: XP_003749059
RGD: 6492303
Ensembl: ENSRNOG00000049179
UniProt: D3ZZY5
Position
1q41
AA seq 917 aa
MAAVLEGPKPEETAAAAEDAARPTVEAVASRPGVPILLAGNQLNLDLRPGGCRRLQYLCS
QQHTQLLQVEFLRLSTHEDPRLLDDTLAKVPWSLLRLRSLVLKGGQSRGALGACLHGTLT
TLPASMRDLACLAHLDLSFNRLETLPTCVLELHSLDALLLSHNCLSELPEALGALPTLTF
LTVTHNLLERLPPTLGSLSTLQRLDLSENLLDTIPSEIGDLSSLRELNLASNRLQHLPAS
LAGLRSLRLLVLHSNLLTSVPPGLAHLPLITRLDLRDNQLRDLPAELLDAPFVRLQGNPL
GEASPAPPSPPDISQVPEMPRLFLTSDLDSFLVTPHGCSVTLACGVRLQFPAGATTTPIT
IHYRLWLPEPGLVSLGPHDFLLSGVLELQPHGVAFQQNVSLWLLFVPPRVRVRRCREVVV
RTRSDNIWNDLETHLEEEAPKRRWARCQVPHFSWFLVVLRPVSNTCLLPPEGALLCSSGH
PGVKVTFPPGVTEEPRQVSMQVVHMAGLELRALLEESEAAVSPLLCLSQSGPPSFLQPVT
VQLPLPPGVTGFSLDRSHLHLLYRTPLTSTWDDISTQVALEFTHLYARFQVTHFSWYWLW
YTTKTCVGGLARKAWERLRLHRVNLIALQRRRDPEQVLLQCLPRSKVDATLSRLLDRYRG
PEPSETVEMFEGEKFFAAFERGIDVDADRPDCVDGRICFVFYSHLKNMKEVYITTALDRE
AQDVRGQVSFYRGSLPMEVPEEAEAARRRKGTDALWMATLPIKLPRLRGAQGSGQGTDFS
LMPLNLGDAETGFLTQSNLLSVASRLGSDWPTVALHLGMPYRKLQRIRHEFRDDLDGQIR
HMLFSWAESQTGQPGAVGHLVQALEQSDRQDVAEEVRAILELGRHKYQDSIRRTGLAPED
STLPSTSALQNPESAQA
NT seq 2754 nt   +upstreamnt  +downstreamnt
atggctgcagtgttggaggggccgaagccagaggaaactgcagctgctgcagaggatgct
gcaagacccacagtggaggctgtggcttccaggcccggagtacctattctcctggctggg
aaccagttgaatctggacctacgccctgggggctgccgtcggctgcagtacctgtgttcc
cagcagcacacacagctgctgcaagtggagtttttgcggctcagcacccacgaggaccct
cgactgctagatgacaccctagccaaggttccgtggagtctactgcgccttcgctccctg
gtcctcaaaggtggccagagtcggggtgccctgggtgcttgcctccatggtaccctaacc
actctgcctgctagcatgagagacttagcctgcctggcccacctagacctgagcttcaac
aggctggagacactgccgacctgtgtcctggaactgcacagcttggatgccttgctgctt
tctcacaactgtctctcagagctgccagaggccctgggggcactgcctaccctcaccttc
ctcactgtgacacacaacctcctggaaagactacccccaacactggggtccctgtccacc
cttcagcgtcttgatctctccgagaaccttctagacaccatcccgtctgagattggagac
ctgagcagcctcagggagctcaatctggcctccaaccggctgcagcatctcccagcttcc
cttgcggggctgcggtccctgcggctccttgttctgcacagcaacctcttgacctcggtg
ccccctggcttggcccacctgccactgatcactcggcttgacctgagggacaaccagctc
agagacctacctgccgagctactagacgctccctttgtgcgcctgcaggggaaccctctg
ggcgaggcctctcctgcacccccaagtcccccagacatttcccaggttccagaaatgccc
aggctattcctgacctcagacttggacagcttccttgtgactccccatggctgttctgtg
accctggcctgtggtgtccgcctacagttcccagcaggagccaccaccacacctatcacc
atccactatcgactgtggttgcctgagccaggcctagtctctctgggacctcatgacttc
ctgcttagtggtgtcctggagctgcagcctcatggggtggctttccagcagaatgtgagc
ttatggctgctctttgtccccccacgagtccgagtccgtcgttgccgtgaggtagttgtg
agaacacggagtgacaacatctggaatgacctagagacccacctggaggaagaggccccc
aagaggcgttgggctcgctgccaggtgccccacttctcctggttcctggtcgttttacgc
ccagtatccaacacctgcctattaccaccagagggagcacttctgtgctcctcaggtcat
cctggggtcaaagtcacttttccccctggggtcacagaagagccccggcaagtctccatg
caggtagtgcatatggctggactagagctgagagcccttctggaagagtcagaggcggca
gtgagccccttgctgtgcctttcccagagcggaccccccagcttcctacaacctgtcact
gtgcagttgcccttgccccccggtgttacaggcttcagtctggaccgctcccacttacat
ctgctctaccgaacacccctgacaagcacctgggatgacatcagcactcaggtggcactg
gaattcacccacctgtacgcacgcttccaggtcacacacttctcctggtactggctctgg
tataccaccaaaacctgcgtggggggcctggcccggaaggcctgggaacggctgcggctg
caccgtgtaaacctcattgcactgcagaggcgccgagacccggagcaggtcctgctgcag
tgcctgccccggagcaaggtagatgccaccctgagccggctgctggatcggtaccgtggc
ccggaaccctctgagactgtggagatgtttgagggtgagaagttctttgcagcctttgag
cggggcatcgatgtagatgctgaccgtccagactgtgtggatggcagaatctgttttgtc
ttctattcacacctgaagaatatgaaggaggtatacattaccacagccttggaccgtgaa
gctcaggatgttcgaggacaggtgtccttttatcggggttcacttcccatggaggtgcct
gaagaggcagaggctgcccggcggaggaagggcacagatgcattgtggatggccaccttg
cccatcaagctaccgagactccggggggcccaggggagtgggcagggaactgacttctcc
ttgatgcctctgaacctgggtgatgcagaaactggattcctgactcagagcaacctgctg
agtgtggcctcacgccttggttctgactggccgactgtggccctgcacctaggcatgccc
taccgtaagcttcagcgtatccgacatgaattcagggatgacctggatgggcagatccgc
cacatgctcttctcttgggctgagagccagactggacagcctggagctgtgggacacctg
gtgcaggccttggagcagagtgaccggcaggatgtggctgaagaggtgcgtgccatcttg
gaacttggccgtcacaagtaccaggacagcattcggcgcacagggctggcccctgaggat
tccactctgcctagcacctcagctttacagaacccagagtctgcacaggcctag

DBGET integrated database retrieval system