KEGG   Rattus norvegicus (rat): 100911581Help
Entry
100911581         CDS       T01003                                 

Definition
(RefSeq) fatty-acid amide hydrolase 1-like
  KO
K15528  fatty acid amide hydrolase [EC:3.5.1.99]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100911581
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.99  fatty acid amide hydrolase
     100911581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase bZIP_1
Motif
Other DBs
NCBI-GeneID: 100911581
NCBI-ProteinID: XP_003750049
RGD: 6491947
Ensembl: ENSRNOG00000045949
UniProt: P97612
Structure
PDB: 

Position
5q35
AA seq 579 aa AA seqDB search
MVLSEVWTTLSGVSGVCLACSLLSAAVVLRWTGRQKARGAATRARQKQRASLETMDKAVQ
RFRLQNPDLDSEALLTLPLLQLVQKLQSGELSPEAVFFTYLGKAWEVNKGTNCVTSYLTD
CETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAV
PFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCE
HLFTLDPTVPPLPFREEVYRSSRPLRVGYYETDNYTMPSPAMRRALIETKQRLEAAGHTL
IPFLPNNIPYALEVLSAGGLFSDGGRSFLQNFKGDFVDPCLGDLILILRLPSWFKRLLSL
LLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPMLGPALD
LNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMK
NSVGLPVAVQCVALPWQEELCLRFMREVEQLMTPQKQPS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgagcgaagtgtggaccacgctgtctggggtctccggggtttgcctagcctgc
agcttgttgtcggcggcggtggtcctgcgatggaccgggcgccagaaggcccggggcgcg
gcgaccagggcgcggcagaagcagcgagccagcctggagaccatggacaaggcggtgcag
cgcttccggctgcagaatcctgacctggactcggaggccttgctgaccctgcccctactc
caactggtacagaagttacagagtggagagctgtccccagaggctgtgttctttacttac
ctgggaaaggcctgggaagtgaacaaagggaccaactgcgtgacctcctatctgaccgac
tgtgagactcagctgtcccaggccccacggcagggcctgctctatggtgtccctgtgagc
ctcaaggaatgcttcagctacaagggccacgactccacactgggcttgagcctgaatgag
ggcatgccatcggaatctgactgtgtggtggtgcaagtgttgaagctgcagggagctgtg
ccctttgtgcataccaatgtcccccagtccatgttaagctttgactgcagtaaccctctc
tttggccagaccatgaacccatggaagtcctccaagagcccaggaggttcctcagggggt
gagggggctctcattggatctggaggttcccctctgggtttaggcactgacattggcggc
agcatccggttcccttctgccttctgcggcatctgtggcctcaagcctactggcaaccgc
ctcagcaagagtggcctgaagggctgtgtctatggacagacggcagtgcagctttctctt
ggccccatggcccgggatgtggagagcctggcgctatgcctgaaagctctactgtgtgag
cacttgttcaccttggaccctaccgtgcctcccttgcccttcagagaggaggtctataga
agttctagacccctgcgtgtggggtactatgagactgacaactataccatgcccagccca
gctatgaggagggctctgatagagaccaagcagagacttgaggctgctggccacacgctg
attcccttcttacccaacaacataccctacgccctggaggtcctgtctgcgggcggcctg
ttcagtgacggtggccgcagttttctccaaaacttcaaaggtgactttgtggatccctgc
ttgggagacctgatcttaattctgaggctgcccagctggtttaaaagactgctgagcctc
ctgctgaagcctctgtttcctcggctggcagcctttctcaacagtatgcgtcctcggtca
gctgaaaagctgtggaaactgcagcatgagattgagatgtatcgccagtctgtgattgcc
cagtggaaagcgatgaacttggatgtgctgctgacccccatgttgggccctgctctggat
ttgaacacaccgggcagagccacaggggctatcagctacaccgttctctacaactgcctg
gacttccctgcgggggtggtgcctgtcaccactgtgaccgccgaggacgatgcccagatg
gaactctacaaaggctactttggggatatctgggacatcatcctgaagaaggccatgaaa
aatagtgtcggtctgcctgtggctgtgcagtgcgtggctctgccctggcaggaagagctg
tgtctgaggttcatgcgggaggtggaacagctgatgacccctcaaaagcagccatcgtga

DBGET integrated database retrieval system