KEGG   Rattus norvegicus (rat): 100911615
Entry
100911615         CDS       T01003                                 

Definition
(RefSeq) patatin-like phospholipase domain-containing protein 2-like
  KO
K16816  patatin-like phospholipase domain-containing protein 2 [EC:3.1.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00561  Glycerolipid metabolism
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04923  Regulation of lipolysis in adipocytes
Module
rno_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100911615
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100911615
  09159 Environmental adaptation
   04714 Thermogenesis
    100911615
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     100911615
SSDB
Motif
Pfam: Patatin
Other DBs
NCBI-GeneID: 100911615
NCBI-ProteinID: XP_003749062
RGD: 6492173
Ensembl: ENSRNOG00000047551
UniProt: P0C548
Position
1q41
AA seq 478 aa
MFPRETKWNISFAGCGFLGVYHIGVASCLREHAPFLVANATHIYGASAGALTATALVTGA
CLGEAGANIIEVSKEARKRFLGPLHPSFNLVKTIRGCLLKTLPADCHTRASGRLGISLTR
VSDGENVIISHFSSKDELIQANVCSTFIPVYCGLIPPTLQGVRYVDGGISDNLPLYELKN
TITVSPFSGESDICPQDSSTNIHELRITNTSIQFNLRNLYRLSKALFPPEPMVLREMCKQ
GYRDGLRFLRRNGLLNQPNPLLALPPVVPQEEDAEEAAVTEERTGGEDRILEHLPARLNE
ALLEACVEPKDLMTTLSNMLPVRLATAMMVPYTLPLESAVSFTIRLLEWLPDVPEDIRWM
KEQTGSICQYLVMRAKRKLGDHLPSRLSEQVELRRAQSLPSVPLSCATYSEALPNWVRNN
LSLGDALAKWEECQRQLLLGLFCTNVAFPPDALRMRAPASPTATDPATPQDPSGLPPC
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgttcccaagggagaccaagtggaacatctcgttcgctggctgcggcttcctcggggtc
taccacattggagtggcctcctgcctccgtgagcacgcgcccttcctggtggccaacgcc
actcacatctacggagcctcggcaggggcgcttaccgccacagcgctggtcactggggcc
tgcctgggcgaagcgggtgccaacattattgaggtgtccaaggaggctcggaagcggttc
ctgggtcccctgcacccctccttcaacctggtaaagaccatccgtggttgtctactgaag
accctgcctgctgattgccacacgcgtgccagcggacgcctgggcatctccctgactcga
gtttcggatggagagaatgtcatcatatcgcactttagctccaaggatgagcttatccag
gccaatgtttgcagcacttttatccctgtgtactgtggcctcattcctcctacccttcaa
ggggtgcgctatgtggatggcggcatttcagacaacttgccactttatgagctgaagaat
accatcacagtgtccccattctcaggcgagagtgacatctgcccacaagacagctccacc
aacatccacgaacttcgtatcaccaacaccagcatccaattcaacctgcgcaatctctac
cgcctctcgaaggctctcttcccgccagagcccatggttctccgagagatgtgcaaacag
ggctaccgagatggacttcgattccttaggaggaatggcctactgaaccaacccaaccct
ttgctggcactgcccccggttgtcccccaggaagaggatgcagaggaagctgccgtgact
gaggagaggactggaggggaggatcggattctagagcacctgcctgccagactcaacgag
gccctgctggaggcctgtgtggaaccgaaagacctgatgaccaccctttccaacatgctg
ccagtgcgcctggccactgccatgatggtaccctatactctgccactggagagcgcagtg
tccttcaccatccgtttgttggagtggctgcctgatgtccctgaggatatccggtggatg
aaggagcagacaggtagcatctgccagtatctggtgatgagggccaagaggaaattgggt
gaccatctaccttccagactgtctgagcaggtggagctgcggcgtgcccagtctctgccg
tctgtgccactgtcttgcgccacctacagtgaggcactgcccaactgggtacgaaacaac
ctctcactgggggacgcgctggccaagtgggaagaatgccagcgtcagctactgctgggt
ctcttctgcaccaatgtggccttcccgcctgatgccttgcgcatgcgcgcacctgccagc
cccaccgccacagatcctgccaccccacaggatccatctggcctcccaccttgctga

DBGET integrated database retrieval system