KEGG   Rattus norvegicus (rat): 100911672
Entry
100911672         CDS       T01003                                 

Definition
(RefSeq) atrophin-1-like
  KO
K05626  atrophin-1 (dentatorubral-pallidoluysian atrophy protein)
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    100911672
SSDB
Motif
Pfam: Atrophin-1
Other DBs
NCBI-GeneID: 100911672
NCBI-ProteinID: XP_003750706
RGD: 6491795
Ensembl: ENSRNOG00000049575
UniProt: G3V7W3
Position
9q13
AA seq 1184 aa
MKTRQNKDSMSMRSGRKKEAPGPREELRSRGRASPGGVSTSSSDGKAEKSRQTAKKARVE
ETSTPKANKQGRSEEISESESEETSAPKKTKTEELPRPQSPSDLDSLDGRSINDDGSSDP
RDIDQDNRSTSPSIYSPGSVENDSDSSSGLSQGPARPYHPPPLFPPSPPPPDSIPRQPES
GFEPHPSVPPTGYHAPMEPPTSRLFQGPPPGAPPPHPQLYPGSAGGGVLSGPPMGPKGGA
AASSVGPPSGGKQHPPPTTPIPISSSGASGAPPAKPPNTPVGAGNLPSAPPPATFPHVTP
NLPPPPALRPLNNASASPPGMGAQPIPGHLPSPHAMGQGMSGLPPGPEKGPTLAPSPHPL
PPASSSAPGPPMRYPYSSCSSSSVAASSSSSAATSQYPASQTLPSYPHSFPPPTSMSVSN
QPPKYTQPSLPSQAVWSQGPPPPPPYGRLLPNNNTHPGPFPPTGGQSTAHPPAPAHHHHQ
QQQQPQPQPQPQPQQHHHGNSGPPPPGAYPHPLESSNSHHAHPYNMSPSLGSLRPYPPGP
AHLPPSHGQVSYSQAGPNGPPVSSSSNSSGSSSQAAYSCSHPSSSQGPQGASYPFPPVPP
ITTSSATLSTVIATVASSPAGYKTASPPGPPQYSKRAPSPGSYKTATPPGYKPGSPPSFR
TGTPPGYRGTSPPAGPGTFKPGSPTVGPGPLPPAGPSSLSSLPPPPAAPTTGPPLTATQI
KQEPAEEYETPESPVPPARSPSPPPKVVDVPSHASQSARFNKHLDRGFNSCARSDLYFVP
LEGSKLAKKRADLVEKVRREAEQRAREEKEREREREREKEREREKERELERSVKLAQEGR
APVECPSLGPVPHRPPFEPGSAVATVPPYLGPDTPALRTLSEYARPHVMSPGNRNHPFYV
PLGAVDPGLLGYNVPALYSSDPAAREREREARERDLRDRLKPGFEVKPSELEPLHGVPGP
GLDPFPRHGGLALQPGPPGLHPFPFHPSLGPLERERLALAAGPALRPDMSYAERLAAERQ
HAERVAALGNDPLARLQMLNVTPHHHQHSHIHSHLHLHQQDAIHAASASVHPLIDPLASG
SHLTRIPYPAGTLPNPLLPHPLHENEVLRHQLFAAPYRDLPASLSAPMSAAHQLQAMHAQ
SAELQRLALEQQQWLHAHHPLHSVPLPAQEDYYSHLKKESDKPL
NT seq 3555 nt   +upstreamnt  +downstreamnt
atgaagacacgacagaataaagactcgatgtcaatgaggagtggacggaagaaagaggcc
cccgggccccgggaagagctgagatcgaggggccgggcctcccctggaggggtcagcacg
tccagcagtgatggcaaagccgagaaatccaggcagacagccaagaaggcccgagtagag
gagacctctaccccaaaagccaacaagcagggccggagcgaggagatctcagagagtgaa
agcgaagagaccagtgcgcccaaaaagaccaagaccgaggagcttccgcgcccacagtct
ccctcggatctggacagcttagatggccgcagcatcaacgatgacggcagcagtgaccct
agagatatagaccaggacaaccgaagcacatcccccagcatctacagccctggcagtgtg
gaaaatgactcggattcatcctctggcctgtcccagggcccggctcgcccctaccaccca
cctccactctttcctccttcccctccaccaccagacagcattccccgacagccagagtct
ggctttgaaccgcacccttctgtgccgcctactggatatcatgctccaatggagcccccc
acatctcggttattccagggcccacctcctggagctcctcccccacacccacagctctac
cctgggagtgctggtggaggtgttttatctggaccccccatgggtcccaaagggggagca
gccgcctcctcagtgggtccccctagtgggggcaagcagcaccccccacccactacccca
attccaatatcaagctctggggccagtggcgctcctccagcaaagccccccaatactcca
gtgggtgctgggaacttaccttctgctccaccaccagctactttcccccacgtgacacca
aacctgcctcctccacctgccctgagacccctcaacaatgcctcagcctctcctcctggc
atgggggctcagccaatccctgggcatctgccctctccccatgccatggggcagggtatg
agtggacttcctcctggcccagagaagggcccaaccctggccccctctccccacccttta
cccccggcttcttcctccgctcctgggcccccaatgcggtacccgtattcatcctgctcc
agtagctctgttgcagcgtcttctagttcctccgccgccacctcccagtacccagcttcc
cagaccctgcccagttaccctcactccttccccccaccaacaagtatgtctgtctctaat
cagccacccaagtacacccagccttctctcccatcccaggctgtgtggagccagggccca
cctcctcctcctccttatggccgcctcttgcccaacaacaacactcatccgggccctttc
cctcctaccgggggtcaatccacagcccacccgccagcccctgcacatcaccatcaccag
cagcagcagcagccacagccacagccacagccacagccgcaacaacatcatcatggaaac
tctgggccccctccacctggggcatatcctcaccccctagagagcagtaactcccaccat
gcacacccttacaacatgtcaccctccctggggtctttgaggccctacccaccagggcca
gcacacctgcctccgtctcatggccaggtgtcttatagccaagcaggtcccaatggtccc
ccggtttcttcttcttccaactcttccgggtcttcgtctcaagccgcctattcatgctca
cacccttcttcatcccagggcccccaaggggcatcctaccccttcccaccagttcctcca
atcaccacctcctcagctactctttccactgtcatcgccaccgtggcttcctcgccagca
ggttataagacagcctcaccacctggcccccctcagtacagcaagagagccccatcccca
gggtcctacaagacagccaccccgcctggatacaagccagggtcaccaccgtccttcaga
acagggaccccacctggctatcgaggcacctctccgccagcaggcccagggaccttcaag
ccaggttcacccaccgtggggccggggcccctaccacccgcggggccttcaagtttgtca
tctctgcctccaccacccgcggccccgactacagggccgcccctgactgccacgcagatc
aaacaggaaccagctgaagagtatgaaacccccgagagtccggtgcctccggctcgcagc
ccctcgccccctcctaaggtggtggacgtgcctagccatgccagccagtcagccaggttc
aataagcacctggaccgtggcttcaactcgtgcgcgcgcagcgacctgtactttgtgccg
ctggagggatccaagctggccaagaagcgcgcggacctggtggagaaagtgcggcgcgag
gccgagcagcgcgcgcgcgaagaaaaagagcgcgagcgcgagcgggaacgtgagaaggag
cgcgagcgcgagaaagagcgcgagctggagcgcagtgtgaaattggcccaggagggccgt
gctccagtggagtgcccgtccctgggtccagtgccccatcggcctccctttgaacctggc
agcgctgtggctaccgtgcccccttacctgggtcctgatactccagccctgcgcactctc
agtgaatacgcccgacctcatgtcatgtctcctggcaatcgcaaccacccattctatgtg
cccttgggggcagtggacccggggcttctgggttacaatgtcccagccctgtacagcagc
gacccagctgcccgagaacgggagcgggaagcccgtgaacgtgacctccgtgaccggctc
aagcctggctttgaggtgaaacctagtgagctggaacccctacatggggtccccgggcca
ggcctggatcccttcccccgacacgggggcctggctctacaacctgggccacctggcctg
catcctttcccttttcatccgagcctggggcccctggaacgagaacggctagcgctggca
gctgggccagccctgcgtcctgacatgtcttatgctgagcggttggcagctgaaaggcag
catgcagaaagggtggcagccctgggcaatgacccactagcccggctgcagatgctcaac
gtgactccccatcatcaccagcactcccacatccactctcacctacacctgcaccagcag
gatgccatccatgcggcctccgcctcggtgcaccctctcattgaccccctggcctcaggg
tctcaccttacccggatcccctacccagctgggaccctccctaatccccttcttcctcac
cctctgcacgagaacgaagttcttcgtcaccagctctttgctgccccttaccgggaccta
ccggcctctctatctgcgccaatgtcagccgcccatcagctgcaggccatgcacgcacag
tcagccgagctgcagcgcttggcactggaacagcaacagtggctgcacgctcatcaccca
ttgcacagcgtgccgctgcctgcccaggaggactactacagtcacctgaagaaggagagt
gacaagccgctgtag

DBGET integrated database retrieval system