KEGG   Rattus norvegicus (rat): 100911758Help
Entry
100911758         CDS       T01003                                 

Definition
(RefSeq) olfactory receptor 143-like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 100911758
NCBI-ProteinID: XP_003749701
RGD: 6490860
Ensembl: ENSRNOG00000049320
UniProt: M0R9R7
Position
4q11
AA seq 313 aa AA seqDB search
MKKIIMENDSFVSEFILMGLTDQPGLQLPLFALFLMNYTATVMGNLSLMSLIFLNSNLHT
PMYFFIFNLSFIDFCYSYVFTPKMLMSFILERNTISFRGCITQLFFFCFFVNSESYVLTA
MAYDRYVAICKPLLYKAIMVPRICCLLIFVSYLIGFVCAMILTGLMFRLKFCNISIINHY
MCDIFPVIRISCSNTYVNELVSSAVVGTGIILCSLLILISYAMILSNILYMSSGKGWSKA
LGTCGSHIITVSFFYGSGLLAYVKPSSAETVGQGKIFSVFYTFLVPMLNPLIYSLQNKDV
KIAVKKTLKRITS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaataattatggagaatgactcttttgtgtctgaatttattcttatgggactg
acagaccaacctgggctccagctgcccctatttgctctgtttttaatgaactacacagcc
actgtgatgggaaacttgagcttaatgagtctcattttcttgaactcaaatcttcatacc
ccgatgtacttttttatcttcaatttgtcctttattgacttttgttattcatatgtcttt
actcccaaaatgctgatgagttttattttagagaggaacaccatctccttcagaggatgc
ataactcagctctttttcttctgcttttttgtgaactctgagagttatgtgctgacagct
atggcctatgatcgctatgtggcaatctgtaagcctttactatacaaggctatcatggta
cctaggatctgttgtcttctgatatttgtttcatatttgatagggtttgtttgtgccatg
atcctcacaggcttaatgtttaggctcaaattttgtaatatcagcatcatcaatcactac
atgtgtgacatcttccctgtcattcggatctcctgcagtaacacctatgtcaatgaactt
gtgagctctgctgtggtgggtacaggtatcattttatgtagcctccttatcttaatctct
tatgctatgatcctttccaatatcctttatatgtcttcaggtaagggttggtccaaagcc
ttgggcacttgtggttctcacatcataactgttagtttcttctatggatctgggctgctt
gcttatgtaaagccatcttctgctgagactgtaggccagggaaaaattttttcagtgttt
tatacatttctggtgcccatgctgaatcctctcatttacagtctccagaacaaagatgtc
aaaattgctgtgaagaaaacattgaagagaatcacaagttaa

DBGET integrated database retrieval system