KEGG   Rattus norvegicus (rat): 100911796
Entry
100911796         CDS       T01003                                 

Definition
(RefSeq) adenosine receptor A3-like isoform b
  KO
K04268  adenosine receptor A3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04071  Sphingolipid signaling pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100911796
   04022 cGMP-PKG signaling pathway
    100911796
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100911796
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    100911796
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    100911796
SSDB
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx NADH_oxidored
Other DBs
NCBI-GeneID: 100911796
NCBI-ProteinID: NP_001289680
RGD: 6491091
Ensembl: ENSRNOG00000015788
Vega: OTTRNOG00000000719
UniProt: P28647
Position
2
AA seq 320 aa
MKANNTTTSALWLQITYITMEAAIGLCAVVGNMLVIWVVKLNRTLRTTTFYFIVSLALAD
IAVGVLVIPLAIAVSLEVQMHFYACLFMSCVLLVFTHASIMSLLAIAVDRYLRVKLTVRY
RTVTTQRRIWLFLGLCWLVSFLVGLTPMFGWNRKVTLELSQNSSTLSCHFRSVVGLDYMV
FFSFITWILIPLVVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLFL
FALCWLPLSIINFVSYFNVKIPEIAMCLGILLSHANSMMNPIVYACKIKKFKETYFVILR
ACRLCQTSDSLDSNLEQTTE
NT seq 963 nt   +upstreamnt  +downstreamnt
atgaaagccaacaataccacgacgagtgccttgtggttgcaaatcacctacatcaccatg
gaggctgccattggtctctgtgctgtagtgggcaacatgctggtcatctgggtggtcaag
ctgaaccgcactctgaggaccaccaccttctatttcatcgtctccctagcactggctgac
attgctgttggggtgctggtcatacccttggccattgccgtcagcctggaggtccagatg
cacttctatgcctgccttttcatgtcctgtgtgcttctggtcttcacccacgcttccatc
atgtccttgctggccattgctgtagaccgatacctgcgagtcaagctgacagtcagatat
agaacggttaccactcaaagaagaatatggctattcctgggcctctgctggctagtgtcc
tttctggtgggactgacccccatgtttggctggaatagaaaagtgaccttagagctctct
caaaacagctccaccctctcatgccacttccgttccgtggtcggcttggattacatggtc
ttcttcagcttcatcacctggatcctcatccccctggttgtcatgtgcatcatctatctg
gacatcttctacatcatccgaaacaaactcagtcaaaatctgactggcttcagagagacg
cgtgcattttacggtcgggagttcaagaccgctaagtccctgtttctggttctcttcttg
tttgccttgtgctggctgcctttgtccatcatcaattttgtttcctactttaatgtgaag
ataccagagattgcaatgtgcctgggcatcctgttgtcccatgcgaactccatgatgaac
cctattgtctacgcctgcaaaataaaaaagttcaaagaaacctactttgtgatcctcaga
gcttgcaggctctgtcagacctcggattctttggactcaaaccttgaacagactactgag
tag

DBGET integrated database retrieval system