KEGG   Rattus norvegicus (rat): 100911958Help
Entry
100911958         CDS       T01003                                 

Definition
(RefSeq) olfactory receptor 147-like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 100911958
NCBI-ProteinID: XP_003750527
RGD: 6489852
Ensembl: ENSRNOG00000049356
UniProt: M0RCI3
Position
8q22
AA seq 310 aa AA seqDB search
MTLGNVSSVKEFILLGLTQKPELQLPLFFLFLGIYVVSVVGNLGLIVLIVLSPHLHTAMY
YFLFNLSFTDLCYSSVITPRMLVGFVKQNIISHAECMTQLFFFAFFIIDECYILTAMAYD
RYAAICKPLLYQVTMSHQVCHLMIVAVYVMGFVGAMAHTGSVLNMTFCDGNIINHYMCDV
PPLRKLSCTSTSSNELVVFIFVGVNVIIPTLTLFVSYTLILSNILSIHSAEGRSKAFSTC
GSHVAAVSLFFGAVAFMYFKPSSAPVDEEKISTIFYTIVGPMLNPFIYSIRNKDVHIALR
KVLKRILLPK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgactttaggaaatgtctcttcagtgaaagaatttatcctgctgggcctcacacagaag
ccggagctccagctgcctctcttcttcctcttcttgggaatctatgtggtctctgtggtg
gggaacctgggcttgattgttctgattgttttgagtcctcacctgcacaccgccatgtac
tactttctcttcaacctctccttcacagatctctgctactcctctgtcataacccccaga
atgctggtgggttttgtgaagcagaacatcatctctcatgctgagtgcatgactcagctc
tttttctttgccttctttattattgatgaatgctatattttgacagcgatggcctatgac
agatatgctgccatctgtaagcccctgctttaccaggtcaccatgtcccatcaggtctgc
cacttgatgattgtggcggtgtatgtaatggggtttgttggtgccatggcccatacaggt
agtgttttaaacatgaccttctgtgatggcaacatcatcaatcactatatgtgtgatgta
ccacctctcaggaaactctcctgcacaagcacctccagcaatgagctggtggttttcatt
tttgtgggtgtcaatgtaataatacctacattgactctctttgtttcttacaccttgatc
ctttccaacatcctcagcatccattctgcagaaggtcgctcaaaagccttcagtacctgt
ggctcccatgtagcagctgtttctcttttcttcggagctgtagccttcatgtattttaag
ccttctagtgcacctgtagatgaagagaaaatctctaccattttttataccattgtgggt
ccaatgctgaatcctttcatctacagtataaggaataaggatgtccacattgcactgaga
aaagttttgaagagaattcttttacctaagtag

DBGET integrated database retrieval system