KEGG   Rattus norvegicus (rat): 100912032Help
Entry
100912032         CDS       T01003                                 

Gene name
Rps27a
Definition
(RefSeq) ribosomal protein S27a
  KO
K02977  small subunit ribosomal protein S27Ae
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    100912032 (Rps27a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    100912032 (Rps27a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100912032 (Rps27a)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    100912032 (Rps27a)
  Archaea
    100912032 (Rps27a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100912032 (Rps27a)
  Exosomal proteins of colorectal cancer cells
   100912032 (Rps27a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 DUF2407
Motif
Other DBs
NCBI-GeneID: 100912032
NCBI-ProteinID: NP_001292372
RGD: 6489478
Ensembl: ENSRNOG00000004426
UniProt: P62982 Q6PED0
Structure
PDB: 

Position
14q22
AA seq 156 aa AA seqDB search
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE
CPSDECGAGVFMGSHFDRHYCGKCCLTYCFNKPEDK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcagatttttgtgaagacccttacagggaagaccatcacgctcgaggttgaaccctcg
gacactatagaaaatgtaaaggccaagatccaggataaggaaggaattcctcctgatcag
cagaggttgatctttgctggtaagcagttggaagatggccgtactttgtctgactacaac
attcaaaaggagtccactctccatctcgtgctgagacttcgtggtggcgctaagaaaagg
aagaagaagtcttacaccaccccaaagaagaacaagcataagagaaagaaggtcaagttg
gctgtgctgaaatactataaggtggatgaaaatggcaaaatcagccgacttcgtcgggaa
tgtccttctgatgaatgtggtgctggagttttcatgggtagccactttgacaggcattac
tgtggcaagtgttgtctgacttactgcttcaacaaaccagaagacaagtag

DBGET integrated database retrieval system