KEGG   Rattus norvegicus (rat): 100912034
Entry
100912034         CDS       T01003                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11-like
  KO
K04546  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04062  Chemokine signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04371  Apelin signaling pathway
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04926  Relaxin signaling pathway
rno05032  Morphine addiction
rno05034  Alcoholism
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100912034
   04371 Apelin signaling pathway
    100912034
   04151 PI3K-Akt signaling pathway
    100912034
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100912034
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100912034
  09156 Nervous system
   04724 Glutamatergic synapse
    100912034
   04727 GABAergic synapse
    100912034
   04725 Cholinergic synapse
    100912034
   04728 Dopaminergic synapse
    100912034
   04726 Serotonergic synapse
    100912034
   04723 Retrograde endocannabinoid signaling
    100912034
  09159 Environmental adaptation
   04713 Circadian entrainment
    100912034
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100912034
  09165 Substance dependence
   05032 Morphine addiction
    100912034
   05034 Alcoholism
    100912034
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100912034
   05163 Human cytomegalovirus infection
    100912034
   05167 Kaposi sarcoma-associated herpesvirus infection
    100912034
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    100912034
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    100912034
SSDB
Motif
Pfam: G-gamma DUF5660 HAUS5 DUF2508 COG2 Macoilin Cep57_CLD_2
Other DBs
NCBI-GeneID: 100912034
NCBI-ProteinID: XP_003749746
RGD: 6489513
Ensembl: ENSRNOG00000050469
UniProt: P61954
Position
4q13
AA seq 73 aa
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPED
KNPFKEKGSCVIS
NT seq 222 nt   +upstreamnt  +downstreamnt
atgcccgcccttcacattgaggatctgccggaaaaggaaaaactgaagatggaggttgag
caacttcgcaaagaagtgaagttgcagagacaacaggtgtctaaatgttctgaggaaata
aagaactacattgaagaacgttctggagaggatcctctggtaaagggaattccagaagac
aagaatcccttcaaagaaaagggcagctgtgtcatttcctaa

DBGET integrated database retrieval system