KEGG   Rattus norvegicus (rat): 100912152Help
Entry
100912152         CDS       T01003                                 

Definition
(RefSeq) olfactory receptor 8B3-like
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 100912152
NCBI-ProteinID: XP_008760883
RGD: 6488812
Ensembl: ENSRNOG00000049611
UniProt: M0R5Y1
Position
4q11
AA seq 310 aa AA seqDB search
MVLKNGSLVTEFILLGLTDNPDLQIPLFLVFLVMYMITAFGNLTLILLTVLNSHLHTPMY
FFLFNLSFIDFCYSSVFIPKMLMNFVLKENIIGFAGCMTQLYFFCFFIISECYVLTAMAY
DRYVAICNPLMYSVAMSPKVCSYLMLGSYLMGFFDGMIHTGCILRLTFCDGNIINHYFCD
LVPLMQLSCTSTYVNEVEIFIVGGKDIAVPSIIIFISYGFILYSILQIKSNVGRSKAFNT
CSSHIIAVSLFFGSCAFMYLKPSSAGSLNEGKVSSVFYTIVVPMMNPLIYSLRNKDVKLA
LRNTLSRKKV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtcctgaaaaatggctctttggtaacagaattcattctcttgggattaacagataac
cctgacctccaaatacccctgttcttagttttcctagttatgtatatgatcactgccttt
gggaacttgaccttgatccttctaactgtgctgaactctcaccttcacacccctatgtac
tttttcctctttaacttgtctttcatagacttctgctattcttctgtttttatacccaaa
atgctgatgaactttgttctaaaggagaacattattggttttgcaggctgtatgactcaa
ctctacttcttctgtttttttatcatctctgaatgctatgtcctgacagcaatggcctat
gatcgctatgtcgctatttgtaatccactcatgtatagtgttgccatgtcccctaaagtc
tgttcttatcttatgcttggttcatatttgatgggattttttgatggcatgatccatact
ggctgtatcctgagactgaccttctgtgatgggaacatcatcaaccactacttctgtgat
cttgtgcctttgatgcagctctcctgcacaagcacctatgtaaacgaggtagagattttc
attgtaggggggaaagatatcgctgtacccagtattatcatctttatttcttatggcttc
atcctctatagtatcctccaaataaaatcaaatgttggcagatctaaagccttcaacacc
tgcagctcccatataattgctgtttccctgttttttgggtcatgtgcatttatgtaccta
aagccctcctcagctggatctttgaatgaggggaaagtgtcttctgtcttctataccatt
gtggtccccatgatgaaccctttaatctacagcttgagaaacaaagatgttaagcttgct
ctgagaaatactttgagcaggaaaaaggtttag

DBGET integrated database retrieval system