KEGG   Rattus norvegicus (rat): 100912195
Entry
100912195         CDS       T01003                                 

Definition
(RefSeq) protein BEX1-like
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: BEX
Other DBs
NCBI-GeneID: 100912195
NCBI-ProteinID: XP_006229378
RGD: 6488322
Ensembl: ENSRNOG00000033844
UniProt: A0A096MIT8
Position
1q22
AA seq 128 aa
MESKDQGAKNLNVENDHQKKEEKEEKPQDTIKREPVVAPTFEAGKNCAPRGGRRRFRVRQ
PISHYRWDLMHRVGEAQGRMRDENVQRFGEDMRHLMGKLRERQLSHSLRAVSTDPPHHDH
NDEFCLMP
NT seq 387 nt   +upstreamnt  +downstreamnt
atggagtccaaagatcaaggagcaaaaaatctcaacgtggaaaatgaccatcagaaaaag
gaggaaaaggaagaaaagccgcaagataccatcaaaagggagccggttgtggcccccact
tttgaggctggcaaaaattgtgcgcctagaggaggtcgcaggcggttccgcgttaggcag
cccatttcccactatagatgggacctgatgcacagggttggagaggcccagggcaggatg
agagatgagaatgtgcaaaggtttggggaggatatgagacacctcatgggcaagttgagg
gaaaggcagctgagccatagtctgcgggcggtgagcactgacccccctcaccatgaccac
aatgatgagttttgccttatgccctga

DBGET integrated database retrieval system