KEGG   Rattus norvegicus (rat): 100912314
Entry
100912314         CDS       T01003                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05320  Autoimmune thyroid disease
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100912314
   04151 PI3K-Akt signaling pathway
    100912314
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100912314
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100912314
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100912314
   04621 NOD-like receptor signaling pathway
    100912314
   04622 RIG-I-like receptor signaling pathway
    100912314
   04623 Cytosolic DNA-sensing pathway
    100912314
   04650 Natural killer cell mediated cytotoxicity
    100912314
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100912314
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100912314
   05161 Hepatitis B
    100912314
   05160 Hepatitis C
    100912314
   05171 Coronavirus disease - COVID-19
    100912314
   05164 Influenza A
    100912314
   05162 Measles
    100912314
   05168 Herpes simplex virus 1 infection
    100912314
   05163 Human cytomegalovirus infection
    100912314
   05167 Kaposi sarcoma-associated herpesvirus infection
    100912314
   05169 Epstein-Barr virus infection
    100912314
   05165 Human papillomavirus infection
    100912314
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100912314
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100912314
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100912314
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    100912314
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   100912314
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100912314
NCBI-ProteinID: XP_038967026
RGD: 6487699
Ensembl: ENSRNOG00000056992
Position
5
AA seq 191 aa
MARLCAFLMILIVMSYCRSTCCLGCDLPHTHNLRNKRAFTLLAQMRRLSPVSCLKDRQDF
GFPLEKVDGQQIQKAQAIPVLHELTQQILSLFTSKESSTAWDATLLDSFCNDLQQQLSGL
QACQMQQVGVQESHLAQEDSLLAVREYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSA
NLLARLREEKK
NT seq 576 nt   +upstreamnt  +downstreamnt
atggctaggctttgtgctttcctgatgatcctgatcgtgatgagctattgtagatcaacc
tgctgtctaggatgtgacctgcctcatactcataacctcaggaacaagagagcattcaca
ctcctggcacaaatgaggagactctcccctgtctcctgcctgaaggacagacaggacttt
ggattccccttggagaaggtggatggccagcagatccagaaggctcaagctatccctgtc
ctgcatgagctgacccagcagatcctcagcctcttcacatcaaaggagtcatctactgct
tgggatgcaaccctcctagactcattctgcaatgacctccagcagcagctgagtggtctg
caagcctgtcagatgcagcaagtgggggtgcaggaatctcacctggcccaggaagactcc
ctattggctgtgcgggaatacttccacaggatcactgtgtacctgagagagaagaaacac
agcccctgtgcctgggaggtggtcagagcagaagtctggagagctctgtcttcttcagcc
aacttgctggcaagactaagagaagagaagaaatga

KEGG   Rattus norvegicus (rat): 24481
Entry
24481             CDS       T01003                                 

Gene name
Ifnb1
Definition
(RefSeq) interferon beta precursor
  KO
K05415  interferon beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04668  TNF signaling pathway
rno05135  Yersinia infection
rno05142  Chagas disease
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    24481 (Ifnb1)
   04668 TNF signaling pathway
    24481 (Ifnb1)
   04151 PI3K-Akt signaling pathway
    24481 (Ifnb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24481 (Ifnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    24481 (Ifnb1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    24481 (Ifnb1)
   04621 NOD-like receptor signaling pathway
    24481 (Ifnb1)
   04622 RIG-I-like receptor signaling pathway
    24481 (Ifnb1)
   04623 Cytosolic DNA-sensing pathway
    24481 (Ifnb1)
   04650 Natural killer cell mediated cytotoxicity
    24481 (Ifnb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    24481 (Ifnb1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    24481 (Ifnb1)
   05161 Hepatitis B
    24481 (Ifnb1)
   05160 Hepatitis C
    24481 (Ifnb1)
   05171 Coronavirus disease - COVID-19
    24481 (Ifnb1)
   05164 Influenza A
    24481 (Ifnb1)
   05162 Measles
    24481 (Ifnb1)
   05168 Herpes simplex virus 1 infection
    24481 (Ifnb1)
   05163 Human cytomegalovirus infection
    24481 (Ifnb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24481 (Ifnb1)
   05169 Epstein-Barr virus infection
    24481 (Ifnb1)
   05165 Human papillomavirus infection
    24481 (Ifnb1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    24481 (Ifnb1)
   05152 Tuberculosis
    24481 (Ifnb1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    24481 (Ifnb1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24481 (Ifnb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24481 (Ifnb1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   24481 (Ifnb1)
SSDB
Motif
Pfam: Interferon YWFCY
Other DBs
NCBI-GeneID: 24481
NCBI-ProteinID: NP_062000
RGD: 2865
Ensembl: ENSRNOG00000006268
UniProt: P70499
Position
5
AA seq 184 aa
MANRWTLHIAFLLCFSTTALSIDYKQLQFRQSTSIRTCQKLLRQLNGRLNLSYRTDFKIP
MEVMHPSQMEKSYTAFAIQVMLQNVFLVFRSNFSSTGWNETIVESLLDELHQQTELLEII
LKEKQEERLTWVTSTTTLGLKSYYWRVQRYLKDKKYNSYAWMVVRAEVFRNFSIILRLNR
NFQN
NT seq 555 nt   +upstreamnt  +downstreamnt
atggccaacaggtggaccctccacattgcgttcctgctgtgcttctccaccactgccctc
tccatcgactacaagcagctccagttccgacaaagcactagcattcggacatgtcagaag
ctcctgaggcagctgaatggaaggctcaacctcagctacaggacggacttcaagatccct
atggaggtgatgcacccgtcacagatggagaagagttacactgcctttgccattcaagtg
atgctccagaatgtctttcttgtcttcagaagcaatttctccagcactgggtggaatgag
actattgttgaaagtctcttggatgaactacatcagcagacagagcttctggagataata
ctaaaggaaaagcaagaggaaagattgacttgggtgacatccacgactactttaggcttg
aagagctattactggagggtacaaaggtaccttaaagacaagaagtacaacagctatgcc
tggatggtggtccgagcagaagtcttcaggaacttttccattattctaagacttaataga
aacttccagaactga

KEGG   Rattus norvegicus (rat): 298205
Entry
298205            CDS       T01003                                 

Gene name
Ifna4
Definition
(RefSeq) interferon, alpha 4 precursor
  KO
K05414  interferon alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05320  Autoimmune thyroid disease
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    298205 (Ifna4)
   04151 PI3K-Akt signaling pathway
    298205 (Ifna4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    298205 (Ifna4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    298205 (Ifna4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    298205 (Ifna4)
   04621 NOD-like receptor signaling pathway
    298205 (Ifna4)
   04622 RIG-I-like receptor signaling pathway
    298205 (Ifna4)
   04623 Cytosolic DNA-sensing pathway
    298205 (Ifna4)
   04650 Natural killer cell mediated cytotoxicity
    298205 (Ifna4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    298205 (Ifna4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    298205 (Ifna4)
   05161 Hepatitis B
    298205 (Ifna4)
   05160 Hepatitis C
    298205 (Ifna4)
   05171 Coronavirus disease - COVID-19
    298205 (Ifna4)
   05164 Influenza A
    298205 (Ifna4)
   05162 Measles
    298205 (Ifna4)
   05168 Herpes simplex virus 1 infection
    298205 (Ifna4)
   05163 Human cytomegalovirus infection
    298205 (Ifna4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    298205 (Ifna4)
   05169 Epstein-Barr virus infection
    298205 (Ifna4)
   05165 Human papillomavirus infection
    298205 (Ifna4)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    298205 (Ifna4)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    298205 (Ifna4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    298205 (Ifna4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    298205 (Ifna4)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   298205 (Ifna4)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 298205
NCBI-ProteinID: NP_001100137
RGD: 1306334
Ensembl: ENSRNOG00000033823
UniProt: D3ZFH0
Position
5
AA seq 189 aa
MARLCAFLMVLVVMSYWSACCLGCDLPPTLNLRNKRAFTLLAQMRRLSPVSCLKDRQDFG
FPQEKVDAQQIQKAQTIPVLHELSQQVLNIFTSKDSSAAWNATLLDSFCNDLHQQLSDLK
VCLMQQVGMQEPPLTQEDSLLAVREYFHRITVYLTEKKHSPCAWEVVRAEVWRALSSSVY
LLAKLSEEK
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatggttctggtggtgatgagctactggtcagcctgc
tgtctaggatgtgacctgcctcccactctcaatctcaggaacaagagagccttcacactc
ctggcacaaatgaggagactctcccctgtctcctgcctgaaggacagacaggactttgga
ttcccccaggagaaggtggatgcccagcagatccagaaggctcaaaccatccctgttctg
catgagctgtcccagcaggtcctgaacatcttcacatcaaaggactcatctgctgcttgg
aatgcaaccctcctagactcattctgcaatgacctccaccagcagctcagtgacctcaaa
gtctgtctgatgcagcaggttggaatgcaagaacctcccctaacccaagaagactccctg
ctggctgtgcgggaatacttccacaggatcactgtgtacctgacagagaagaaacacagc
ccctgtgcctgggaagtggtcagagcagaagtgtggagagccctgtcttcctcagtctac
ttgctagcaaaactgagtgaggagaagtga

KEGG   Rattus norvegicus (rat): 298210
Entry
298210            CDS       T01003                                 

Gene name
Ifna5
Definition
(RefSeq) interferon alpha-1 precursor
  KO
K05414  interferon alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05320  Autoimmune thyroid disease
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    298210 (Ifna5)
   04151 PI3K-Akt signaling pathway
    298210 (Ifna5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    298210 (Ifna5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    298210 (Ifna5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    298210 (Ifna5)
   04621 NOD-like receptor signaling pathway
    298210 (Ifna5)
   04622 RIG-I-like receptor signaling pathway
    298210 (Ifna5)
   04623 Cytosolic DNA-sensing pathway
    298210 (Ifna5)
   04650 Natural killer cell mediated cytotoxicity
    298210 (Ifna5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    298210 (Ifna5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    298210 (Ifna5)
   05161 Hepatitis B
    298210 (Ifna5)
   05160 Hepatitis C
    298210 (Ifna5)
   05171 Coronavirus disease - COVID-19
    298210 (Ifna5)
   05164 Influenza A
    298210 (Ifna5)
   05162 Measles
    298210 (Ifna5)
   05168 Herpes simplex virus 1 infection
    298210 (Ifna5)
   05163 Human cytomegalovirus infection
    298210 (Ifna5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    298210 (Ifna5)
   05169 Epstein-Barr virus infection
    298210 (Ifna5)
   05165 Human papillomavirus infection
    298210 (Ifna5)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    298210 (Ifna5)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    298210 (Ifna5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    298210 (Ifna5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    298210 (Ifna5)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   298210 (Ifna5)
SSDB
Motif
Pfam: Interferon RIX1
Other DBs
NCBI-GeneID: 298210
NCBI-ProteinID: NP_001014786
RGD: 1359312
Ensembl: ENSRNOG00000031046
UniProt: P05011
Position
5
AA seq 192 aa
MARLCAFLMSLVVVSYWSACCLGCDLPHTHNLRNKRVFTLLAQMRRLSPVSCLKDRKYFG
FPLEKVDGQQIQKAQAIPVLHELTQQILSLFTSKESSTAWDATLLDSFCNDLQQQLSGLQ
ACLMQQVGVQESPLTQEDSLLAVREYFHRITVYLRENKHSPCAWEVVKAEVWRALSSSAN
LMGRLREERNES
NT seq 579 nt   +upstreamnt  +downstreamnt
atggctcggctctgtgctttcttgatgtccctggtggtggtgagctactggtcagcctgc
tgtctaggatgtgacctgcctcatactcataacctcaggaacaagagagtcttcacactc
ctggcacaaatgaggagactctcccctgtctcatgcctgaaggacagaaagtactttggg
ttccctttggagaaggtggatggccagcagatccagaaggctcaagctatccctgtcctg
catgagctgacccagcagatcctcagcctcttcacatcaaaggagtcatctactgcttgg
gatgcaaccctcctagactcattctgtaatgacctccagcagcagctgagtggtctgcaa
gcctgtctgatgcagcaggtaggggtgcaggaatctcccctgacccaggaagactcccta
ctggctgtgagggaatacttccacagaatcactgtgtacctgagagagaataaacacagc
ccctgtgcctgggaggtggtcaaagcagaagtctggagagccctgtcttcctcagccaac
ttgatgggaagactgagagaagaaagaaatgagtcctga

KEGG   Rattus norvegicus (rat): 298213
Entry
298213            CDS       T01003                                 

Gene name
Ifna2
Definition
(RefSeq) interferon alpha family, gene 2 precursor
  KO
K05414  interferon alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05320  Autoimmune thyroid disease
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    298213 (Ifna2)
   04151 PI3K-Akt signaling pathway
    298213 (Ifna2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    298213 (Ifna2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    298213 (Ifna2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    298213 (Ifna2)
   04621 NOD-like receptor signaling pathway
    298213 (Ifna2)
   04622 RIG-I-like receptor signaling pathway
    298213 (Ifna2)
   04623 Cytosolic DNA-sensing pathway
    298213 (Ifna2)
   04650 Natural killer cell mediated cytotoxicity
    298213 (Ifna2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    298213 (Ifna2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    298213 (Ifna2)
   05161 Hepatitis B
    298213 (Ifna2)
   05160 Hepatitis C
    298213 (Ifna2)
   05171 Coronavirus disease - COVID-19
    298213 (Ifna2)
   05164 Influenza A
    298213 (Ifna2)
   05162 Measles
    298213 (Ifna2)
   05168 Herpes simplex virus 1 infection
    298213 (Ifna2)
   05163 Human cytomegalovirus infection
    298213 (Ifna2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    298213 (Ifna2)
   05169 Epstein-Barr virus infection
    298213 (Ifna2)
   05165 Human papillomavirus infection
    298213 (Ifna2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    298213 (Ifna2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    298213 (Ifna2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    298213 (Ifna2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    298213 (Ifna2)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   298213 (Ifna2)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 298213
NCBI-ProteinID: NP_001258147
RGD: 1311425
Ensembl: ENSRNOG00000058365
UniProt: A0A0G2K3I2
Position
5
AA seq 192 aa
MARLCAFLMSLVVMSYWSACCLGCDLPHTHNLRNKRAFTLLAQMRRLSPVSCLKDRKDFG
FPLEKVDGQQIQKAQAIPVLHELTQQILSLFTSKESSTAWDASLLDSFCNDLQQQLSGLQ
ACLMQQVGVQESPLTQEDSLLAVREYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAN
LLGRLREERNES
NT seq 579 nt   +upstreamnt  +downstreamnt
atggctcggctctgtgctttcttgatgtccctggtggtgatgagctactggtcagcctgc
tgtctaggatgtgacctgcctcacactcataacctcaggaacaagagagccttcacactc
ctggcacaaatgaggagactctcccctgtctcatgcctgaaggacagaaaggactttggg
ttccctttggagaaggtggatggccagcagatccagaaggctcaagctatccctgtcctg
catgagctgacccagcagatcctcagcctcttcacatcaaaggagtcatctactgcttgg
gatgcatccctgctagactcattctgtaatgacctccagcagcagctgagtggtctgcaa
gcctgtctgatgcagcaggtaggggtgcaggaatctcccctgacccaggaagactcccta
ctggctgtgagggaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaac
ttgctgggaagactgagagaagaaagaaatgagtcctga

KEGG   Rattus norvegicus (rat): 500491
Entry
500491            CDS       T01003                                 

Gene name
Ifna16l1
Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05320  Autoimmune thyroid disease
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    500491 (Ifna16l1)
   04151 PI3K-Akt signaling pathway
    500491 (Ifna16l1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    500491 (Ifna16l1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    500491 (Ifna16l1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    500491 (Ifna16l1)
   04621 NOD-like receptor signaling pathway
    500491 (Ifna16l1)
   04622 RIG-I-like receptor signaling pathway
    500491 (Ifna16l1)
   04623 Cytosolic DNA-sensing pathway
    500491 (Ifna16l1)
   04650 Natural killer cell mediated cytotoxicity
    500491 (Ifna16l1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    500491 (Ifna16l1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    500491 (Ifna16l1)
   05161 Hepatitis B
    500491 (Ifna16l1)
   05160 Hepatitis C
    500491 (Ifna16l1)
   05171 Coronavirus disease - COVID-19
    500491 (Ifna16l1)
   05164 Influenza A
    500491 (Ifna16l1)
   05162 Measles
    500491 (Ifna16l1)
   05168 Herpes simplex virus 1 infection
    500491 (Ifna16l1)
   05163 Human cytomegalovirus infection
    500491 (Ifna16l1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    500491 (Ifna16l1)
   05169 Epstein-Barr virus infection
    500491 (Ifna16l1)
   05165 Human papillomavirus infection
    500491 (Ifna16l1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    500491 (Ifna16l1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    500491 (Ifna16l1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    500491 (Ifna16l1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    500491 (Ifna16l1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   500491 (Ifna16l1)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 500491
NCBI-ProteinID: XP_575856
RGD: 1565225
Ensembl: ENSRNOG00000033602
UniProt: D4A428
Position
5
AA seq 191 aa
MARLCAFLMILIVMSYCRSTCCLGCDLPHTHNLRNKRAFTLLAQMRRLSPVSCLKDRQDF
GFPLEKVDGQQIQKAQAIPVLQELTQQILSLFTSKESFTAWDATLLDSFCNDLQQQLSGL
QACQMQQVGVKESHLAQEDSLLAVREYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSA
NLLARLREEKK
NT seq 576 nt   +upstreamnt  +downstreamnt
atggctaggctttgtgctttcctgatgatcctgatcgtgatgagctattgtagatcaacc
tgctgtctaggatgtgacctgcctcatactcataacctcaggaacaagagagcattcaca
ctcctggcacaaatgaggagactctcccctgtctcctgcctgaaggacagacaggacttt
ggattccccttggagaaggtggatggccagcagatccagaaggctcaagctatccctgtc
ctgcaagagctaacccagcagatcctcagcctcttcacatcaaaggagtcatttactgct
tgggatgcaaccctcctagactcattctgcaatgacctccagcagcagctgagtggtctg
caagcctgtcagatgcagcaagtgggggtgaaggaatctcacctggcccaggaagactcc
ctactggctgtgcgggaatatttccataggatcactgtgtacctgagagagaagaaacac
agtccctgtgcctgggaggtggtcagagcagaagtctggagagctctgtcttcttcagcc
aacttgctggcaagactaagagaagagaagaaatga

KEGG   Rattus norvegicus (rat): 502961
Entry
502961            CDS       T01003                                 

Gene name
RGD1559679
Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05320  Autoimmune thyroid disease
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    502961 (RGD1559679)
   04151 PI3K-Akt signaling pathway
    502961 (RGD1559679)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    502961 (RGD1559679)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    502961 (RGD1559679)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    502961 (RGD1559679)
   04621 NOD-like receptor signaling pathway
    502961 (RGD1559679)
   04622 RIG-I-like receptor signaling pathway
    502961 (RGD1559679)
   04623 Cytosolic DNA-sensing pathway
    502961 (RGD1559679)
   04650 Natural killer cell mediated cytotoxicity
    502961 (RGD1559679)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    502961 (RGD1559679)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    502961 (RGD1559679)
   05161 Hepatitis B
    502961 (RGD1559679)
   05160 Hepatitis C
    502961 (RGD1559679)
   05171 Coronavirus disease - COVID-19
    502961 (RGD1559679)
   05164 Influenza A
    502961 (RGD1559679)
   05162 Measles
    502961 (RGD1559679)
   05168 Herpes simplex virus 1 infection
    502961 (RGD1559679)
   05163 Human cytomegalovirus infection
    502961 (RGD1559679)
   05167 Kaposi sarcoma-associated herpesvirus infection
    502961 (RGD1559679)
   05169 Epstein-Barr virus infection
    502961 (RGD1559679)
   05165 Human papillomavirus infection
    502961 (RGD1559679)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    502961 (RGD1559679)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    502961 (RGD1559679)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    502961 (RGD1559679)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    502961 (RGD1559679)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   502961 (RGD1559679)
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 502961
NCBI-ProteinID: XP_038967027
RGD: 1559679
Position
5
AA seq 189 aa
MPSLSAFLVVLVVMSHWSACCLGCDLPPTLNLRNKRAFTLLAQMRRLSPVSCLKDRKDFG
FPLEKVDAQQIQKAQAISILHELSQQVLNIYTSKDSSAAWDATLLDSFCNDLQQQLSGLQ
ACQMHQVGVQEPPLAQEDSLLAVREYFHRITVYLREKKHSSCAWEVVRAEVWRALSSSAN
LLSRLREEK
NT seq 570 nt   +upstreamnt  +downstreamnt
atgcctagtctctctgctttcctagtggtcctggtggtgatgagccactggtcagcctgc
tgtctaggatgtgacctgcctcccactctcaatctcaggaacaagagagccttcacactc
ctggcacaaatgaggagactctcccctgtctcatgcctgaaggacagaaaggactttgga
ttccctttggagaaggtggatgcccagcagatccagaaggctcaagccatctctatcctg
catgagctgtcccagcaggtcctgaatatctacacatcaaaggactcatctgctgcttgg
gatgcaaccctcctagattcattctgcaatgacctccagcagcagctgagtggtctgcaa
gcctgtcagatgcatcaagtgggggtgcaggaacctcctctggcccaggaagactccctg
ctggctgtgagggaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
tcctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaac
ttgctgtcaagactgagagaagagaagtga

KEGG   Rattus norvegicus (rat): 690894
Entry
690894            CDS       T01003                                 

Gene name
Ifna1
Definition
(RefSeq) interferon alpha-5
  KO
K05414  interferon alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05320  Autoimmune thyroid disease
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    690894 (Ifna1)
   04151 PI3K-Akt signaling pathway
    690894 (Ifna1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    690894 (Ifna1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    690894 (Ifna1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    690894 (Ifna1)
   04621 NOD-like receptor signaling pathway
    690894 (Ifna1)
   04622 RIG-I-like receptor signaling pathway
    690894 (Ifna1)
   04623 Cytosolic DNA-sensing pathway
    690894 (Ifna1)
   04650 Natural killer cell mediated cytotoxicity
    690894 (Ifna1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    690894 (Ifna1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    690894 (Ifna1)
   05161 Hepatitis B
    690894 (Ifna1)
   05160 Hepatitis C
    690894 (Ifna1)
   05171 Coronavirus disease - COVID-19
    690894 (Ifna1)
   05164 Influenza A
    690894 (Ifna1)
   05162 Measles
    690894 (Ifna1)
   05168 Herpes simplex virus 1 infection
    690894 (Ifna1)
   05163 Human cytomegalovirus infection
    690894 (Ifna1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    690894 (Ifna1)
   05169 Epstein-Barr virus infection
    690894 (Ifna1)
   05165 Human papillomavirus infection
    690894 (Ifna1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    690894 (Ifna1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    690894 (Ifna1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    690894 (Ifna1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    690894 (Ifna1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   690894 (Ifna1)
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 690894
NCBI-ProteinID: XP_001076062
RGD: 1306135
Position
5
AA seq 189 aa
MARPCAFLIALVVMMYWSTCSLGCALLQQQSLRNKRALTFLTQIRRFSPVSCLKDRKDFG
FPLEKMDAQQIQKTQAIPILYELTQQVLNIFTSKDSSAAWDATLLDSFCNNLHQQLNDLK
ACLMQQSGVQEPPLTQEDSLLYVKEYFHRISVYLREKKHSPCAWEVVRAEVWRALSSSAK
LLTRQSKEE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggccctgtgctttcctgattgccctggtggtgatgatgtactggtcaacctgc
tctctaggatgtgccctgcttcagcaacaaagcctcaggaacaagagagccttaacattc
ctgactcaaataaggagattttcccctgtctcttgcttgaaagacagaaaggactttgga
ttccctttggagaagatggatgcccagcagatccagaagactcaagcgatccctattcta
tatgagctgacccagcaggtcctgaacatcttcacatcaaaggactcatctgctgcttgg
gatgcaaccctccttgactcattctgcaataatctccaccagcagctcaatgacctcaaa
gcctgtttgatgcagcagagtggggtgcaggaacctcccttgactcaggaagactccctg
ctgtatgtgaaggaatacttccacaggatctctgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaaa
ttgctgacaagacagagtaaggaggagtga

DBGET integrated database retrieval system