KEGG   Rattus norvegicus (rat): 100912489
Entry
100912489         CDS       T01003                                 

Definition
(RefSeq) histone H4-like
  KO
K11254  histone H4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100912489
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100912489
  09165 Substance dependence
   05034 Alcoholism
    100912489
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    100912489
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100912489
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 100912489
NCBI-ProteinID: XP_008761668
RGD: 6486649
Ensembl: ENSRNOG00000045978
UniProt: P62804
Position
4q43
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggacgagggaaaggcggcaaaggtctgggtaaaggtggcgccaagcgacaccgc
aaggttctccgagataacatccagggcattaccaagcccgctatccggcgtttggctcgg
cgcggcggtgtcaagcgtatctcaggtcttatctacgaggagactcgcggcgtcctgaag
gttttccttgaaaatgtgattcgcgatgctgtcacctacaccgagcacgccaagcgcaag
acggtcacggctatggacgtggtgtacgcgctcaagcgccagggccgcacgctctatggc
ttcggcggctga

DBGET integrated database retrieval system