KEGG   Rattus norvegicus (rat): 100912525Help
Entry
100912525         CDS       T01003                                 

Gene name
Hoxa4, Hox1r2, hox1.4
Definition
(RefSeq) homeo box A4
  KO
K09304  homeobox protein HoxA/B/C/D4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    100912525 (Hoxa4)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    100912525 (Hoxa4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN DUF2209
Motif
Other DBs
NCBI-GeneID: 100912525
NCBI-ProteinID: NP_077326
RGD: 2814
Ensembl: ENSRNOG00000027365
UniProt: E9PT77
Position
4q24
AA seq 285 aa AA seqDB search
MTMSSFLINSNYIEPKFPPFEEFAPHGGPGGGDGGVGGGPGYPRPQSSPHLPAPNPHAAR
QTPAYYAPRAREPSYHGGLYPAPAAACPYACRGASPARPEQSPAPGAHPSPAPQPPAPPR
RCAPGPTTPAVATGGSAPACPLLLADQGPAGPKGKEPVVYPWMKKIHVSAVNPSYNGGEP
KRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHK
LPNTKMRSSNPASAPAGPPGKAQTHSPHPHPHPLPGASTPIPSSI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgagctcgtttttgataaactccaactacatcgagcccaagttccctcccttc
gaggagttcgcaccgcacggtggcccgggcggtggggacggcggcgtgggcgggggtccc
ggctacccgcggcctcagagctccccgcacctgccggccccgaacccgcacgcggcccga
cagacccccgcatactacgcgccaagggcgcgcgagcccagctaccacgggggcctgtac
cccgcgcccgccgccgcctgtccctacgcctgtcgcggggccagccccgcgcgacccgag
cagtccccggcccccggcgcgcatcccagcccggccccgcagccccctgcgccccctcgg
cgctgcgctccgggccccaccaccccggctgtcgcgacggggggcagcgcccccgcgtgc
ccgctgctgctggcggaccagggccccgcgggcccgaagggcaaggagccggtggtgtac
ccctggatgaagaagatccacgtgagcgccgtcaaccccagttataacggaggtgagccc
aagcgctctcgaaccgcctatacccggcagcaagtcttggagctggagaaggaattccac
tttaaccgatacctgacccggcgccgccgcatcgagatcgctcacacgctctgcttgtcc
gagcgccaggtcaagatctggttccagaaccggagaatgaagtggaagaaagaccacaaa
cttcccaacaccaagatgcgatcttccaaccctgcctcggcccctgccggcccgcctggg
aaagcacaaactcacagcccacacccccatccccaccctctccccggtgcttccacaccc
attccctcgtctatataa

DBGET integrated database retrieval system